MRM2

rRNA methyltransferase 2, mitochondrial

320 amino acids

S-adenosyl-L-methionine-dependent 2'-O-ribose methyltransferase that catalyzes the formation of 2'-O-methyluridine at position 2791 (Um2791) in the 21S mitochondrial large subunit ribosomal RNA (mtLSU rRNA), a universally conserved modification in the peptidyl transferase domain of the mtLSU rRNA.

Belongs to the class I-like SAM-binding methyltransferase superfamily. RNA methyltransferase RlmE family.

37.423 kDa

MILVYNRIRSIISSSLGRIHVRYNSNSQNRWLNRQLKDPYTKEAKVQNLRSRAAFKLMQIDDKYRLFSKNRTDQRILDLGYAPGAWSQVARQRSSPNSMILGVDILPCEPPHGVNSIQANILAKRTHDLIRLFFSKHFQLNRHDDLHKDHGYFQNMLEEELTHVKDTELYREIFTSDDIYETPNTNSTLIEREKFPVDVIISDMYEPWPQTTGFWNNITNQAYFRMANTSGVSIRDHYQSIDLCDAALVTAIDLLRPLGSFVCKLYTGEEENLFKKRMQAVFTNVHKFKPDASRDESKETYYIGLKKKRNVDKLDVFSNS

MRM2

rRNA methyltransferase 2, mitochondrial

246 amino acids

S-adenosyl-L-methionine-dependent 2'-O-ribose methyltransferase that catalyzes the formation of 2'-O-methyluridine at position 1369 (Um1369) in the 16S mitochondrial large subunit ribosomal RNA (mtLSU rRNA), a universally conserved modification in the peptidyl transferase domain of the mtLSU rRNA.

Belongs to the class I-like SAM-binding methyltransferase superfamily. RNA methyltransferase RlmE family.

27.424 kDa

MAGYLKLVCVSFQRQGFHTVGSRCKNRTGAEHLWLTRHLRDPFVKAAKVESYRCRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASRKESSEVYFLATQYHGRKGTVKQ

Mrm2

rRNA methyltransferase 2, mitochondrial

246 amino acids

S-adenosyl-L-methionine-dependent 2'-O-ribose methyltransferase that catalyzes the formation of 2'-O-methyluridine at position 1369 (Um1369) in the 16S mitochondrial large subunit ribosomal RNA (mtLSU rRNA), a universally conserved modification in the peptidyl transferase domain of the mtLSU rRNA.

Belongs to the class I-like SAM-binding methyltransferase superfamily. RNA methyltransferase RlmE family.

27.145 kDa

MAGHLKLVGVPLKVRRLHTAVCHYRGRTGAEHLWLTRHLKDPFVKAAKVESYRCRSAFKLLEMNEKHQILRPGLRVLDCGAAPGAWSQVAVQRVNATGADSSSPVGFVLGVDLLHIFPLAGATFLCPADVTDPRTFQKILELLPSRRADVILSDMAPNATGIRDLDHDKLISLCLTLVDMAVDILHPGGTLLCKTWAGSKSHLLQKRLTQEFQSTRVVKPEASRKESSEVYLLATQYRGGKGTRRP

mrm2

rRNA methyltransferase 2, mitochondrial

218 amino acids

S-adenosyl-L-methionine-dependent 2'-O-ribose methyltransferase that catalyzes the formation of the 2'-O-methyluridine corresponding to position 2791 in S.cerevisiae 21S mitochondrial large subunit ribosomal RNA (mtLSU rRNA), a universally conserved modification in the peptidyl transferase domain of the mtLSU rRNA.

Belongs to the class I-like SAM-binding methyltransferase superfamily. RNA methyltransferase RlmE family.

24.743 kDa

MFGSKTLFSWAAKRSKDFYRKKSKIDNFRSRAAYKLIELNSKYRFINKEDVVIDVGFAPGSWSQVAKKLVGNKGKVIGIDIQHIAPPEGVLPIYGDIRDPNTLTKLFEALRLLHEPNTNDSIDCRVVDAVISDMLHKATGIRIRDHALSMELCASALHVALTFLKSNGSFICKFYMGDEDADLQNLLKSHFRFVQVMKPKASLKESREAYFVCLERKP