Mpig6b

Megakaryocyte and platelet inhibitory receptor G6b

242 amino acids

Inhibitory receptor that acts as a critical regulator of hematopoietic lineage differentiation, megakaryocyte function and platelet production (PubMed:23112346). Inhibits platelet aggregation and activation by agonists such as ADP and collagen-related peptide (By similarity). This regulation of megakaryocate function as well as platelet production ann activation is done through the inhibition (via the 2 ITIM motifs) of the receptors CLEC1B and GP6:FcRgamma signaling (PubMed:23112346). Appears to operate in a calcium-independent manner (By similarity).

26.01 kDa

MALVLPLLPLLLSKVQGNPEVSLEGSPGDRVNLSCIGVSDPTRWAWAPSFPACKGLSKGRRPILWASTRGTPTVLQHFSGRLRSLDNGIKRLELLLSAGDSGTFFCKGRHENESRTVLQVLGDKAGCRPAGSTHGYEYPKVLIPLLGVGLVLGLGVAGVVWRRRRLSPPPPPPPPPGPLPTFAPVINAEPQRPLEQESKISGHLDQEPSLHYADLDHSVLGRHRRMSTVVSGDASTVYAVVV

MPIG6B

Megakaryocyte and platelet inhibitory receptor G6b

241 amino acids

Isoform B, displayed in this entry, is the only isoform to contain both a transmembrane region and 2 immunoreceptor tyrosine-based inhibitor motifs (ITIMs) and, thus, the only one which probably has a role of inhibitory receptor. Isoform A may be the activating counterpart of isoform B.

26.163 kDa

MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQLLIPLLGAGLVLGLGALGLVWWLHRRLPPQPIRPLPRFAPLVKTEPQRPVKEEEPKIPGDLDQEPSLLYADLDHLALSRPRRLSTADPADASTIYAVVV

Mpig6b

Megakaryocyte and platelet inhibitory receptor G6b

232 amino acids

Inhibitory receptor that acts as a critical regulator of hematopoietic lineage differentiation, megakaryocyte function and platelet production. Inhibits platelet aggregation and activation by agonists such as ADP and collagen-related peptide. This regulation of megakaryocate function as well as platelet production ann activation is done through the inhibition (via the 2 ITIM motifs) of the receptors CLEC1B and GP6:FcRgamma signaling. Appears to operate in a calcium-independent manner.

25.083 kDa

MALVLQLLPLLLSKVQGNPEVSLEGNPGDRVNLSCIGVSDPTRWAWAPSFPACKGLSKGRRPILWASSSGTPTVLQHFSGRLRSLDTGIKRLELLLSAGDSGTFFCKGRQENESRTVIQVLGDKAGCRPSGSTHGSEYSKVLIPLLGFGLVLGLGALGLVWWRRSCVPPSHIAPVINAEPQRPLEQDSKISGHLDQEPNLHYADLDHSVLRRHRRMSALVPGDASTVYAVVV