Protein
Mitogen-activated protein kinase kinase 5
Organism
Arabidopsis thaliana
Function
Involved in the second phase of hydrogen peroxide generation during hypersensitive response-like cell death. Involved in the innate immune MAP kinase signaling cascade (MEKK1, MKK4/MKK5 and MPK3/MPK6) downstream of bacterial flagellin receptor FLS2. Activates by phosphorylation the downstream MPK3 and MPK6. YDA-MKK4/MKK5-MPK3/MPK6 module regulates stomatal cell fate before the guard mother cell (GMC) is specified. This MAPK cascade also functions downstream of the ER receptor in regulating coordinated local cell proliferation, which shapes the morphology of plant organs. MKK4 and MKK5 participate in the regulation of floral organ abscission. Target of the Pseudomonas syringae type III effector HopF2, that inhibits the activation of the downstream MPK6 and PAMP-triggered immunity. Plays a critical role in high light stress tolerance by the mediation of the Cu/Zn SODs CSD1 and CSD2 gene expression. Phosphorylates BZR1 in vitro.
Similarity
Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily.
Sequence
MKPIQSPSGVASPMKNRLRKRPDLSLPLPHRDVALAVPLPLPPPSSSSSAPASSSAISTNISAAKSLSELERVNRIGSGAGGTVYKVIHTPTSRPFALKVIYGNHEDTVRRQICREIEILRSVDHPNVVKCHDMFDHNGEIQVLLEFMDQGSLEGAHIWQEQELADLSRQILSGLAYLHRRHIVHRDIKPSNLLINSAKNVKIADFGVSRILAQTMDPCNSSVGTIAYMSPERINTDLNHGRYDGYAGDVWSLGVSILEFYLGRFPFAVSRQGDWASLMCAICMSQPPEAPATASQEFRHFVSCCLQSDPPKRWSAQQLLQHPFILKATGGPNLRQMLPPPRPLPSAS