MIF

Macrophage migration inhibitory factor homolog

115 amino acids

Tautomerization of the methyl ester of L-dopachrome. Inhibits migration of human peripheral blood mononuclear cells (By similarity).

Belongs to the MIF family.

12.364 kDa

MPYFTIDTNKPQDSISSAFLKKAPNVVPKALGKPESYVSIHVNGGQPMVFGGSEDPCPVCVLKSIGCVGPKVNNSHAEKLYKLLADELKIPKNRCYIESVDIEASSMAFNGSTFG

MIF

Macrophage migration inhibitory factor

115 amino acids

Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity (By similarity).

Belongs to the MIF family.

12.343 kDa

MPMFVVNTNVPRASVPDGLLSELTQQLAQATGKPAQYIAVHVVPDQLMTFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLTERLRISPDRIYINFCDMNAANVGWNGSTFA

MIF

Macrophage migration inhibitory factor

115 amino acids

Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity (By similarity).

Belongs to the MIF family.

12.484 kDa

MPMFTIHTNVCKDAVPDSLLGELTQQLAKATGKPAQYIAVHIVPDQMMSFGGSTDPCALCSLYSIGKIGGQQNKTYTKLLCDMIAKHLHVSADRVYINYFDINAANVGWNGSTFA

MIF

Macrophage migration inhibitory factor

115 amino acids

Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.

Belongs to the MIF family.

12.476 kDa

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

MIF

Macrophage migration inhibitory factor

115 amino acids

Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity (By similarity).

Belongs to the MIF family.

12.476 kDa

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

MIF

Macrophage migration inhibitory factor

115 amino acids

Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity (By similarity).

Belongs to the MIF family.

12.476 kDa

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

MIF

Macrophage migration inhibitory factor

115 amino acids

Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity (By similarity).

Belongs to the MIF family.

12.449 kDa

MPMFIVNTNVPRSSVPEGLLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGSSDPCALCSLHSIGKIGGAQNRTYSKLLCGLLADRLRISPDRIYINYYDMNAANVGWNGSTFA

Mif

Macrophage migration inhibitory factor

115 amino acids

Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity (By similarity).

Belongs to the MIF family.

12.504 kDa

MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

MIF

Macrophage migration inhibitory factor

115 amino acids

Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity (By similarity).

Belongs to the MIF family.

12.451 kDa

MPMFVVNTNVPRASVPDGFLSELTQQLVQAMGKPAQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRIYINYYDMNAANVGWNGSTFA

Mif

Macrophage migration inhibitory factor

115 amino acids

Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity (By similarity).

Belongs to the MIF family.

12.477 kDa

MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTSDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

MIF

Macrophage migration inhibitory factor

115 amino acids

Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity (By similarity).

Belongs to the MIF family.

12.343 kDa

MPMFVVNTNVPRASVPDGLLSELTQQLAQATGKPAQYIAVHVVPDQLMTFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLTERLRISPDRIYINFCDMNAANVGWNGSTFA

mif

Macrophage migration inhibitory factor

115 amino acids

Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense (By similarity). Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity. Required for normal neural development during embryogenesis.

Belongs to the MIF family.

12.5 kDa

MPVFTIRTNVCRDSVPDTLLSDLTKQLAKATGKPAEYIAIHIVPDQIMSFGDSTDPCAVCSLCSIGKIGGPQNKSYTKLLCDILTKQLNIPANRVYINYYDLNAANVGWNGSTFA

mif

Macrophage migration inhibitory factor

115 amino acids

Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity (By similarity).

Belongs to the MIF family.

12.524 kDa

MPTFTVCTNVCRDSMPDTLLSDLTKLLAKATGKPAEYIAIHIMPDQMMSFGDSTDPCAVCSLSSIGKIGGPQNKSYSKLLCDYLTKQMNIPANRVYINFHDLNPANVGWNGSTFA