About Services Proteins Contact

MIC12

Gene
MIC12
Protein
MICOS complex subunit MIC12
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Length
106 amino acids
Function
Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.
Similarity
Belongs to the MICOS complex subunit Mic12 family.
Mass
12.388 kDa
Sequence
MSKLGPLARSVKWTLSVGVIGSVFYLYRYSNNGYFYDHDATWLKQDHQVQDLVDRKEVVPGETRNRKLVVTDDGTAWSRTMGESIKDIWNEQIRNSVDWIYSWGKN