About Services Proteins Contact

MG117

Gene
MG117
Protein
Uncharacterized protein MG117
Organism
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Length
214 amino acids
Mass
24.952 kDa
Sequence
MDKNIFQLVQSFAKTQNVRANYTSQDKNISLDFVSFETVSQSLTGFLIFNNFNKLLQLIELIKQKQTWLYVDQLWIVDLSNNKALTDATVWIIKQEKLPVSVAAFSNQQLNQVYRNSSTSPLYLSYVKPIEVQQFFTLSPSINNNPFLNQNPLTESPFDNNNQLFQATKSVEPSMETMEFSRFMDEFDQITKNFSDIELEPMQFTQSFDDWSKD