MATALPHA1

Mating-type protein ALPHA1

261 amino acids

Mating type proteins are sequence specific DNA-binding proteins that act as master switches in yeast differentiation by controlling gene expression in a cell type-specific fashion. Transcriptional activator that induces the transcription of alpha-specific genes (By similarity). Required for mating as an alpha-cell.

Belongs to the MATALPHA1 family.

30.125 kDa

MKSNAPTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIPAPPQVLVAYIKEKVKTLNKSEVLMSLGNSNQLSSRDVKTKTKKKQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVNYGIDKQWLYEIVQYEECLTPTTKKPYVENIYNSGFKQRIDSPNQKDITFSQSDNSADWLVDPIFFDTEFLATSFDRTNLIISDCYSLMNSV

MATALPHA1

Mating-type protein ALPHA1

195 amino acids

Mating type proteins are sequence specific DNA-binding proteins that act as master switches in yeast differentiation by controlling gene expression in a cell type-specific fashion.

Belongs to the MATALPHA1 family.

22.756 kDa

MMFHVLCFFGNRTSRVANLCLQLKFPPHNDSPKMALDELNLSFLTHLPQIPTTSPLLKRLLTEYGAIDNGKDSLNKVAPKKSSRHRVQKEKKRLNGFMAFRSFYSRNIANYNSQKALSQDLADAWNREKHQQIWSLYAIQYNHSKSKEPFSRWLEMKLSNKLGKFNSDDPTTRREINVMSHIVVEDVFQECSSQY

MATALPHA1

Mating-type protein ALPHA1

194 amino acids

Mating type proteins are sequence specific DNA-binding proteins that act as master switches in yeast differentiation by controlling gene expression in a cell type-specific fashion. Transcriptional activator that induces the transcription of alpha-specific genes (By similarity).

Belongs to the MATALPHA1 family.

22.039 kDa

MSVKTKKFVNKKYTTAKFKVTPTGKCRNKNNESIKKLIFNNGTKINTGLNLLLTQPNQVNIPPPPKILLDRIREERKRMVSSANSDITVIDIELCWEIDKFLAHHFQNTDSSKNDNYTKSNIKKPINAFIAFRAYYSQLGAGIKQNILSSILSEAWNSPETDQNIWDIFAQQFNFASARCGFVNYIMAQASSAP

MATALPHA1

Mating-type protein ALPHA1

175 amino acids

Mating type proteins are sequence specific DNA-binding proteins that act as master switches in yeast differentiation by controlling gene expression in a cell type-specific fashion. Transcriptional coactivator that, in alpha-cells, binds cooperatively with MCM1 and STE12 to a DNA sequence termed the QP' element, to activate the transcription of alpha-specific genes.

Belongs to the MATALPHA1 family.

20.413 kDa

MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRFLNKIQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL