MAIP1

m-AAA protease-interacting protein 1, mitochondrial

291 amino acids

Promotes sorting of SMDT1/EMRE in mitochondria by ensuring its maturation. Interacts with the transit peptide region of SMDT1/EMRE precursor protein in the mitochondrial matrix, leading to protect it against protein degradation by YME1L1, thereby ensuring SMDT1/EMRE maturation by the mitochondrial processing peptidase (PMPCA and PMPCB).

32.94 kDa

MALAVRLLPRLLLSRPLPGWAARLRTLSSAEVKRPLSGLCYLCRRRLGSGAAPFPRVSWASAALALSARGPQRPLLSPLEVASTLPTFPSCPRRTYSTEEQPQQRQKTKMIILGFSNPINWVRTRIYSFLIWAYFDQEFSITEFSEGAKQAFAHVSKLLSQCKFDLLEELVAKETLHVLKEKVTSLPDNHKNALAADIDEIVYTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSEAISGARVFQVKLGDQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHPKLLE

MAIP1

m-AAA protease-interacting protein 1, mitochondrial

291 amino acids

Promotes sorting of SMDT1/EMRE in mitochondria by ensuring its maturation (PubMed:27642048). Interacts with the transit peptide region of SMDT1/EMRE precursor protein in the mitochondrial matrix, leading to protect it against protein degradation by YME1L1, thereby ensuring SMDT1/EMRE maturation by the mitochondrial processing peptidase (PMPCA and PMPCB) (PubMed:27642048).

32.545 kDa

MALAARLLPQFLHSRSLPCGAVRLRTPAVAEVRLPSATLCYFCRCRLGLGAALFPRSARALAASALPAQGSRWPVLSSPGLPAAFASFPACPQRSYSTEEKPQQHQKTKMIVLGFSNPINWVRTRIKAFLIWAYFDKEFSITEFSEGAKQAFAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKNALAANIDEIVFTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSETLRGASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE

Maip1

m-AAA protease-interacting protein 1, mitochondrial

291 amino acids

Promotes sorting of SMDT1/EMRE in mitochondria by ensuring its maturation. Interacts with the transit peptide region of SMDT1/EMRE precursor protein in the mitochondrial matrix, leading to protect it against protein degradation by YME1L1, thereby ensuring SMDT1/EMRE maturation by the mitochondrial processing peptidase (PMPCA and PMPCB).

32.985 kDa

MALAARLLPLPLLSRPLPGPVTRLRTLGSTEVRLTLTEICCLCRRRLGSSAAPIPRYTRAWTSPALRSWSSRRSLLGRVEHPPALASLPASPSRSYSTEEQPQQRQRTRMIILGFSNPINWVRTRIYAFLIWAYFDKEFSIAEFSEGAKQAFAYVSKLLSQCKFDLLEELVAKEVLQILKEKVTSLSDNHKNALAADIDDIVYTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSESLSGANVFQVKLGDQSVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE

Maip1

m-AAA protease-interacting protein 1, mitochondrial

291 amino acids

Promotes sorting of SMDT1/EMRE in mitochondria by ensuring its maturation. Interacts with the transit peptide region of SMDT1/EMRE precursor protein in the mitochondrial matrix, leading to protect it against protein degradation by YME1L1, thereby ensuring SMDT1/EMRE maturation by the mitochondrial processing peptidase (PMPCA and PMPCB).

33.09 kDa

MALAARLLPLPLLSWSLPGRATRLRTLRTTEVKLTLNEFCCLCRRRLGSSAAPIPRCTWAWASPTMRSWGPRRPLLGRAEHSPALASLPASPIRSYSTEEQPQQRQRTRMIILGFSNPINWVRTRIYAFLIWAYFDKEFSIAEFSEGAKQAFAYVSKLLSQCKFDLLEELVAKEVLQVLKEKVASLSDNHKNALAADIDDIVYTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSESLSGANVFQVKLGDQSVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE

MAIP1

m-AAA protease-interacting protein 1, mitochondrial

291 amino acids

Promotes sorting of SMDT1/EMRE in mitochondria by ensuring its maturation. Interacts with the transit peptide region of SMDT1/EMRE precursor protein in the mitochondrial matrix, leading to protect it against protein degradation by YME1L1, thereby ensuring SMDT1/EMRE maturation by the mitochondrial processing peptidase (PMPCA and PMPCB).

32.94 kDa

MALAVRLLPRLLLSRPLPGWAARLRTLSSAEVKRPLSGLCYLCRRRLGSGAAPFPRVSWASAALALSARGPQRPLLSPLEVASTLPTFPSCPRRTYSTEEQPQQRQKTKMIILGFSNPINWVRTRIYSFLIWAYFDQEFSITEFSEGAKQAFAHVSKLLSQCKFDLLEELVAKETLHVLKEKVTSLPDNHKNALAADIDEIVYTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSEAISGARVFQVKLGDQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHPKLLE

MAIP1

m-AAA protease-interacting protein 1, mitochondrial

291 amino acids

Promotes sorting of SMDT1/EMRE in mitochondria by ensuring its maturation (PubMed:27642048). Interacts with the transit peptide region of SMDT1/EMRE precursor protein in the mitochondrial matrix, leading to protect it against protein degradation by YME1L1, thereby ensuring SMDT1/EMRE maturation by the mitochondrial processing peptidase (PMPCA and PMPCB) (PubMed:27642048).

32.545 kDa

MALAARLLPQFLHSRSLPCGAVRLRTPAVAEVRLPSATLCYFCRCRLGLGAALFPRSARALAASALPAQGSRWPVLSSPGLPAAFASFPACPQRSYSTEEKPQQHQKTKMIVLGFSNPINWVRTRIKAFLIWAYFDKEFSITEFSEGAKQAFAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKNALAANIDEIVFTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSETLRGASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE

Maip1

m-AAA protease-interacting protein 1, mitochondrial

291 amino acids

Promotes sorting of SMDT1/EMRE in mitochondria by ensuring its maturation. Interacts with the transit peptide region of SMDT1/EMRE precursor protein in the mitochondrial matrix, leading to protect it against protein degradation by YME1L1, thereby ensuring SMDT1/EMRE maturation by the mitochondrial processing peptidase (PMPCA and PMPCB).

32.985 kDa

MALAARLLPLPLLSRPLPGPVTRLRTLGSTEVRLTLTEICCLCRRRLGSSAAPIPRYTRAWTSPALRSWSSRRSLLGRVEHPPALASLPASPSRSYSTEEQPQQRQRTRMIILGFSNPINWVRTRIYAFLIWAYFDKEFSIAEFSEGAKQAFAYVSKLLSQCKFDLLEELVAKEVLQILKEKVTSLSDNHKNALAADIDDIVYTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSESLSGANVFQVKLGDQSVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE

Maip1

m-AAA protease-interacting protein 1, mitochondrial

291 amino acids

Promotes sorting of SMDT1/EMRE in mitochondria by ensuring its maturation. Interacts with the transit peptide region of SMDT1/EMRE precursor protein in the mitochondrial matrix, leading to protect it against protein degradation by YME1L1, thereby ensuring SMDT1/EMRE maturation by the mitochondrial processing peptidase (PMPCA and PMPCB).

33.09 kDa

MALAARLLPLPLLSWSLPGRATRLRTLRTTEVKLTLNEFCCLCRRRLGSSAAPIPRCTWAWASPTMRSWGPRRPLLGRAEHSPALASLPASPIRSYSTEEQPQQRQRTRMIILGFSNPINWVRTRIYAFLIWAYFDKEFSIAEFSEGAKQAFAYVSKLLSQCKFDLLEELVAKEVLQVLKEKVASLSDNHKNALAADIDDIVYTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSESLSGANVFQVKLGDQSVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE