MAD2

Spindle assembly checkpoint component MAD2

214 amino acids

Central component of the spindle assembly checkpoint which is a feedback control that prevents cells with incompletely assembled spindles from leaving mitosis. Plays a key role in virulence, probably through cell cycle checkpoint functions, especially those monitoring the integrity of DNA and chromosome segregation, which might be required for the pathogen to repair damage caused by host defense.

Belongs to the MAD2 family.

24.54 kDa

MPSSLEPSSKLALKGSSKIVCDYFEFALNSILYQRGIYPQEDFVTVKKYDLPMVINDDYDVQKYINNIMKQIKKWIYGSLMSKFIIVIVSKTNLENIERWEFNIETKDQEETTENGDGDGDGVGKSRQEIQKEIRTIIRQITSSVSYLPVLKDDDEYTFNVLVYTDPNTSVPIEWCDTQGDGKVLDGDNVDNVKFTSFSTDIHQVGTSVSYKYE

MAD2

Mitotic spindle checkpoint protein MAD2

209 amino acids

Required for the execution of the mitotic checkpoint which monitors the process of kinetochore-spindle attachment and delays the onset of anaphase when this process is not complete. It inhibits the activity of the anaphase promoting complex by sequestering CDC20 until all chromosomes are aligned at the metaphase plate.

Belongs to the MAD2 family.

23.731 kDa

MASKTAAAKDIITLHGSAAIVSEFFCYAANSILYNRAVYPEESFVKVKKYGLPMLLIEDESVKSFMSNLTSQISEWLEAGKLQRVVLVIMSKATGEVLERWNFRIETDNEVVDKGVSREKSDKEIMREIQAIMRQVASSVTYLPCLDETCVFDVLAYTDTDVAVPFTWIESDPKLIANPQMVKLHGFDTKIHKVDTLVSYKNDEWDEEE

MAD2

Mitotic spindle checkpoint protein MAD2

208 amino acids

Required for the execution of the mitotic checkpoint which monitors the process of kinetochore-spindle attachment and delays the onset of anaphase when this process is not complete. It inhibits the activity of the anaphase promoting complex by sequestering CDC20 until all chromosomes are aligned at the metaphase plate (By similarity).

Belongs to the MAD2 family.

23.505 kDa

MASRSASKDIITLRGSAAIVSEFFGYAANSILYNRAVYPEESFSKVKKYGLTMLLTQDEGVKNFIASLTSQLSEWLEAGKLQRIVLVIMSKATSEVLERWNFNIVTDAEVVEKGAIKEKSDKEIMREIQAIMRQIASCITYLPCLDEPCVFDVLAYTDTDVDAPGTWVESDAKLIDNPQMVKLHSFDTKIHKVDTLVSYKKDEWDEEE

mad2

Mitotic spindle checkpoint component mad2

203 amino acids

Feedback control that prevents cells with incompletely assembled spindles from leaving mitosis. It interacts with the anaphase promoting complex/cyclosome (APC/C) thereby inhibiting APC/C-dependent proteolysis, a step required for exit from mitosis.

Belongs to the MAD2 family.

23.583 kDa

MSSVPIRTNFSLKGSSKLVSEFFEYAVNSILFQRGIYPAEDFKVVRKYGLNMLVSVDEEVKTYIRKIVSQLHKWMFAKKIQKLILVITSKCSGEDLERWQFNVEMVDTADQFQNIGNKEDELRVQKEIQALIRQITATVTFLPQLEEQCTFNVLVYADKDSEVPTDWVDSDPRILRDAEQVQLRSFSTSMHKIDCQVAYRVNP

MAD2

Mitotic spindle checkpoint component MAD2

196 amino acids

Central component of the spindle assembly checkpoint which is a feedback control that prevents cells with incompletely assembled spindles from leaving mitosis. Thought to be recruited to unattached kinetochores by MAD1. During checkpoint activity, MAD2 is relayed from the MAD1-MAD2 complex to the mitotic checkpoint complex (MCC). MCC and presumably the MAD2-CDC20 subcomplex inhibit the ubiquitin ligase activity of the anaphase promoting complex/cyclosome (APC/C) by preventing its activation by CDC20.

Belongs to the MAD2 family.

22.284 kDa

MSQSISLKGSTRTVTEFFEYSINSILYQRGVYPAEDFVTVKKYDLTLLKTHDDELKDYIRKILLQVHRWLLGGKCNQLVLCIVDKDEGEVVERWSFNVQHISGNSNGQDDVVDLNTTQSQIRALIRQITSSVTFLPELTKEGGYTFTVLAYTDADAKVPLEWADSNSKEIPDGEVVQFKTFSTNDHKVGAQVSYKY