Lyar

Cell growth-regulating nucleolar protein

388 amino acids

Plays a role in the maintenance of the appropriate processing of 47S/45S pre-rRNA to 32S/30S pre-rRNAs and their subsequent processing to produce 18S and 28S rRNAs (By similarity). Also acts at the level of transcription regulation. Along with PRMT5, binds embryonic globin promoter (By similarity). Represses the expression of embryonic globin Hbb-y gene (PubMed:25092918). In neuroblastoma cells, may also repress the expression of oxidative stress genes, including CHAC1, HMOX1, SLC7A11, ULBP1 and that encoding the small nucleolar RNA SNORD41 (By similarity). Preferentially binds to a DNA motif containing 5'-GGTTAT-3' (By similarity). Stimulates phagocytosis of photoreceptor outer segments by retinal pigment epithelial cells (PubMed:25735755). Prevents NCL self-cleavage, maintaining a normal steady-state level of NCL protein in undifferentiated embryonic stem cells (ESCs), which in turn is essential for ESC self-renewal (PubMed:19489080).

43.736 kDa

MVFFTCNACGESVKKIQVEKHVSNCRNCECLSCIDCGKDFWGDDYKSHVKCISEGQKYGGKGYEAKTHKGDAKQQAWIQKINELIKKPNVSPKVRELLQQISAFDNVPRKKAKFQNWMKNSLKVHSDSVLEQVWDIFSEASSSEQDQQQPPSHTAKPHAEMPITKVPSAKTNGTTEEQTEAKKNKRERKEERQKNRKKEKKELKLENHQENLRGQKPKKRKKNQEAGHEAAGEEAAEASGPPEKKKAQGGQASEEGADRNGGPGEDAAEGQTKTAAGKRKRPKHSGAESGYKKKKMKLPEQPEEGEAKDHEAPSKGKFNWKGTIKAVLKQAPDNEISVKKLKKKVIAQYHAVMNDHHTSEEELLAIFNRKISRNPTFKVLKDRVKLLK

Lyar

Cell growth-regulating nucleolar protein

388 amino acids

Plays a role in the maintenance of the appropriate processing of 47S/45S pre-rRNA to 32S/30S pre-rRNAs and their subsequent processing to produce 18S and 28S rRNAs (By similarity). Also acts at the level of transcription regulation. Along with PRMT5, binds embryonic globin promoter (By similarity). Represses the expression of embryonic globin Hbb-y gene (PubMed:25092918). In neuroblastoma cells, may also repress the expression of oxidative stress genes, including CHAC1, HMOX1, SLC7A11, ULBP1 and that encoding the small nucleolar RNA SNORD41 (By similarity). Preferentially binds to a DNA motif containing 5'-GGTTAT-3' (By similarity). Stimulates phagocytosis of photoreceptor outer segments by retinal pigment epithelial cells (PubMed:25735755). Prevents NCL self-cleavage, maintaining a normal steady-state level of NCL protein in undifferentiated embryonic stem cells (ESCs), which in turn is essential for ESC self-renewal (PubMed:19489080).

43.736 kDa

MVFFTCNACGESVKKIQVEKHVSNCRNCECLSCIDCGKDFWGDDYKSHVKCISEGQKYGGKGYEAKTHKGDAKQQAWIQKINELIKKPNVSPKVRELLQQISAFDNVPRKKAKFQNWMKNSLKVHSDSVLEQVWDIFSEASSSEQDQQQPPSHTAKPHAEMPITKVPSAKTNGTTEEQTEAKKNKRERKEERQKNRKKEKKELKLENHQENLRGQKPKKRKKNQEAGHEAAGEEAAEASGPPEKKKAQGGQASEEGADRNGGPGEDAAEGQTKTAAGKRKRPKHSGAESGYKKKKMKLPEQPEEGEAKDHEAPSKGKFNWKGTIKAVLKQAPDNEISVKKLKKKVIAQYHAVMNDHHTSEEELLAIFNRKISRNPTFKVLKDRVKLLK

Lyar

Cell growth-regulating nucleolar protein

386 amino acids

Plays a role in the maintenance of the appropriate processing of 47S/45S pre-rRNA to 32S/30S pre-rRNAs and their subsequent processing to produce 18S and 28S rRNAs. Also acts at the level of transcription regulation. Along with PRMT5, binds embryonic globin promoter (By similarity). Represses the expression of embryonic globin Hbb-y gene (By similarity). In neuroblastoma cells, may also repress the expression of oxidative stress genes, including CHAC1, HMOX1, SLC7A11, ULBP1 and that encoding the small nucleolar RNA SNORD41. Preferentially binds to a DNA motif containing 5'-GGTTAT-3' (By similarity). Stimulates phagocytosis of photoreceptor outer segments by retinal pigment epithelial cells. Prevents NCL self-cleavage, maintaining a normal steady-state level of NCL protein in undifferentiated embryonic stem cells (ESCs), which in turn is essential for ESC self-renewal (By similarity).

43.68 kDa

MVFFTCNACGESVKKIQVEKHVSICRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGGKGYEAKTHKGDVKQQAWIQKINELIKKPNVSPKVRELLQQISAFDNVPRKKAKFQNWMRNSLKVHSDSVLEQVWNIFSEAASSEQDQQPPSHMAKPNTEVPTKVPSTKTNGTTEEQTEAKKNKRERKEERQKSRKKEKKELKLENHQENLKGQKPKKRKKGQEAGHEAGGEDAAEANGAPEKKRARDAQASEEGADRNGGPAEDADEGPTKTAAGKRKRQKHSEVESDNKKKKMKLPGQPEEGEPEDHEAPSKGKFNWKGTIKAVLKQAPDNEISVKKLKKKVIAQYHAVMSDHHTSEEELLAIFNKKISRNPTFKVLKDKVKLLK

LYAR

Cell growth-regulating nucleolar protein

379 amino acids

Plays a role in the maintenance of the appropriate processing of 47S/45S pre-rRNA to 32S/30S pre-rRNAs and their subsequent processing to produce 18S and 28S rRNAs (PubMed:24495227). Also acts at the level of transcription regulation. Along with PRMT5, binds the gamma-globin (HBG1/HBG2) promoter and represses its expression (PubMed:25092918). In neuroblastoma cells, may also repress the expression of oxidative stress genes, including CHAC1, HMOX1, SLC7A11, ULBP1 and SNORD41 that encodes a small nucleolar RNA (PubMed:28686580). Preferentially binds to a DNA motif containing 5'-GGTTAT-3' (PubMed:25092918). Stimulates phagocytosis of photoreceptor outer segments by retinal pigment epithelial cells (By similarity). Prevents nucleolin/NCL self-cleavage, maintaining a normal steady-state level of NCL protein in undifferentiated embryonic stem cells (ESCs), which in turn is essential for ESC self-renewal (By similarity).

43.615 kDa

MVFFTCNACGESVKKIQVEKHVSVCRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGGKGYEGKTHKGDIKQQAWIQKISELIKRPNVSPKVRELLEQISAFDNVPRKKAKFQNWMKNSLKVHNESILDQVWNIFSEASNSEPVNKEQDQRPLHPVANPHAEISTKVPASKVKDAVEQQGEVKKNKRERKEERQKKRKREKKELKLENHQENSRNQKPKKRKKGQEADLEAGGEEVPEANGSAGKRSKKKKQRKDSASEEEAHVGAGKRKRRHSEVETDSKKKKMKLPEHPEGGEPEDDEAPAKGKFNWKGTIKAILKQAPDNEITIKKLRKKVLAQYYTVTDEHHRSEEELLVIFNKKISKNPTFKLLKDKVKLVK

LYAR

Cell growth-regulating nucleolar protein

379 amino acids

Plays a role in the maintenance of the appropriate processing of 47S/45S pre-rRNA to 32S/30S pre-rRNAs and their subsequent processing to produce 18S and 28S rRNAs (PubMed:24495227). Also acts at the level of transcription regulation. Along with PRMT5, binds the gamma-globin (HBG1/HBG2) promoter and represses its expression (PubMed:25092918). In neuroblastoma cells, may also repress the expression of oxidative stress genes, including CHAC1, HMOX1, SLC7A11, ULBP1 and SNORD41 that encodes a small nucleolar RNA (PubMed:28686580). Preferentially binds to a DNA motif containing 5'-GGTTAT-3' (PubMed:25092918). Stimulates phagocytosis of photoreceptor outer segments by retinal pigment epithelial cells (By similarity). Prevents nucleolin/NCL self-cleavage, maintaining a normal steady-state level of NCL protein in undifferentiated embryonic stem cells (ESCs), which in turn is essential for ESC self-renewal (By similarity).

43.615 kDa

MVFFTCNACGESVKKIQVEKHVSVCRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGGKGYEGKTHKGDIKQQAWIQKISELIKRPNVSPKVRELLEQISAFDNVPRKKAKFQNWMKNSLKVHNESILDQVWNIFSEASNSEPVNKEQDQRPLHPVANPHAEISTKVPASKVKDAVEQQGEVKKNKRERKEERQKKRKREKKELKLENHQENSRNQKPKKRKKGQEADLEAGGEEVPEANGSAGKRSKKKKQRKDSASEEEAHVGAGKRKRRHSEVETDSKKKKMKLPEHPEGGEPEDDEAPAKGKFNWKGTIKAILKQAPDNEITIKKLRKKVLAQYYTVTDEHHRSEEELLVIFNKKISKNPTFKLLKDKVKLVK