About Services Proteins Contact

Lcho_1975

Gene
Lcho_1975
Protein
Nucleoid-associated protein Lcho_1975
Organism
Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Length
108 amino acids
Function
Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection.
Similarity
Belongs to the YbaB/EbfC family.
Mass
11.642 kDa
Sequence
MIKGQLAGLMKQAQAMQDNLKKAQDELANVEVEGQSGAGLVKVVMTCKHDVKRLSIDPSLLADDKDMLEDLVAAAFNDAVRRAEAVSQEKMGKLTAGMPLPPGMKFPF