lyrm7

Complex III assembly factor LYRM7

140 amino acids

Assembly factor required for Rieske Fe-S protein UQCRFS1 incorporation into the cytochrome b-c1 (CIII) complex. Functions as a chaperone, binding to this subunit within the mitochondrial matrix and stabilizing it prior to its translocation and insertion into the late CIII dimeric intermediate within the mitochondrial inner membrane (By similarity).

Belongs to the complex I LYR family.

16.104 kDa

MNRAKVLSSYLGLLRTEKKVFQNDKRALEHVINLTRVQFRDNKNETDNTKINEMIDHANAVSHFLVKDLIQGVRKDEKTIQLKFDENTKSYQQYEFVNDQPPQRKKRGKIQIDDEQPTTCCGGGCGKPMPSNNSEKSTCS

LYRM7

Complex III assembly factor LYRM7

104 amino acids

Assembly factor required for Rieske Fe-S protein UQCRFS1 incorporation into the cytochrome b-c1 (CIII) complex. Functions as a chaperone, binding to this subunit within the mitochondrial matrix and stabilizing it prior to its translocation and insertion into the late CIII dimeric intermediate within the mitochondrial inner membrane (By similarity).

Belongs to the complex I LYR family.

11.923 kDa

MGQAAKVLQLFKTLHRTRQQVFKNDARALEAARKKINEEFKCNKTETSPKKIEELIKIGSDVELILRTSVIQGIHTDHNTLKLVPRKDLLIENVPYCDAPTQKQ

LYRM7

Complex III assembly factor LYRM7

104 amino acids

Assembly factor required for Rieske Fe-S protein UQCRFS1 incorporation into the cytochrome b-c1 (CIII) complex. Functions as a chaperone, binding to this subunit within the mitochondrial matrix and stabilizing it prior to its translocation and insertion into the late CIII dimeric intermediate within the mitochondrial inner membrane (By similarity).

Belongs to the complex I LYR family.

12.206 kDa

MGTRLKVLRVFKDLHRTRRDVFRDDNRALTAARVKINEEFKKNKNETSDDNIKEMLKMARAVETILRESVIQAEHVDENKIVLRPRKSLLLENVPYCDAPSKKT

LYRM7

Complex III assembly factor LYRM7

104 amino acids

Assembly factor required for Rieske Fe-S protein UQCRFS1 incorporation into the cytochrome b-c1 (CIII) complex. Functions as a chaperone, binding to this subunit within the mitochondrial matrix and stabilizing it prior to its translocation and insertion into the late CIII dimeric intermediate within the mitochondrial inner membrane.

Belongs to the complex I LYR family.

11.955 kDa

MGRAVKVLQLFKTLHRTRQQVFKNDARALEAARIKINEEFKNNKSETSSKKIEELMKIGSDVELLLRTSVIQGIHTDHNTLKLVPRKDLLVENVPYCDAPTQKQ

Lyrm7

Complex III assembly factor LYRM7

104 amino acids

Assembly factor required for Rieske Fe-S protein UQCRFS1 incorporation into the cytochrome b-c1 (CIII) complex. Functions as a chaperone, binding to this subunit within the mitochondrial matrix and stabilizing it prior to its translocation and insertion into the late CIII dimeric intermediate within the mitochondrial inner membrane (By similarity).

Belongs to the complex I LYR family.

12.047 kDa

MGQPAKVLQLFKTLHRTRQQVFKNDKRALEAARVKINEEFKKHKNETSPEKIKEMMKLGSDVELLLRTAVIQGIHTDHDTLQLVPRKDLLTENVPYCDAPTQKQ

LYRM7

Complex III assembly factor LYRM7

104 amino acids

Assembly factor required for Rieske Fe-S protein UQCRFS1 incorporation into the cytochrome b-c1 (CIII) complex. Functions as a chaperone, binding to this subunit within the mitochondrial matrix and stabilizing it prior to its translocation and insertion into the late CIII dimeric intermediate within the mitochondrial inner membrane (By similarity).

Belongs to the complex I LYR family.

11.951 kDa

MGQAVKVLQLFKTLHRTRQQVFKNDARALEAARIKINEEFKKNKSETSPKKIEELMKIGSDVELLLRTSVIQGIHTDHNTLKLVPRKDLLVENVPYCDAPTQKQ

Lyrm7

Complex III assembly factor LYRM7

104 amino acids

Assembly factor required for Rieske Fe-S protein UQCRFS1 incorporation into the cytochrome b-c1 (CIII) complex. Functions as a chaperone, binding to this subunit within the mitochondrial matrix and stabilizing it prior to its translocation and insertion into the late CIII dimeric intermediate within the mitochondrial inner membrane (By similarity).

Belongs to the complex I LYR family.

12.03 kDa

MGQPAKVLQLFKTLHRTRQQVFKNDKRALEAARVKINEEFKKHKNETSPEKIKEMLKIGSDVELLLRTSVIQGIHTDHDTLQLVPRKDLLTENVPYCDAPTQKL

lyrm7

Complex III assembly factor LYRM7

104 amino acids

Assembly factor required for Rieske Fe-S protein UQCRFS1 incorporation into the cytochrome b-c1 (CIII) complex. Functions as a chaperone, binding to this subunit within the mitochondrial matrix and stabilizing it prior to its translocation and insertion into the late CIII dimeric intermediate within the mitochondrial inner membrane (By similarity).

Belongs to the complex I LYR family.

12.284 kDa

MGTRLKVLRVFKQLQRTRMDVFKDDDIALKAARLKINEEFRKNRNETSEENINEMIKLGSNVETVLRESVLQMEHVGEDKLLLRPRKSLLLENVPYCDEPRKKS

lyrm7

Complex III assembly factor LYRM7

104 amino acids

Assembly factor required for Rieske Fe-S protein UQCRFS1 incorporation into the cytochrome b-c1 (CIII) complex. Functions as a chaperone, binding to this subunit within the mitochondrial matrix and stabilizing it prior to its translocation and insertion into the late CIII dimeric intermediate within the mitochondrial inner membrane (By similarity).

Belongs to the complex I LYR family.

12.122 kDa

MESKMKVLKLFRTLHRTRQCVFQNDHRALEAARQRINEEFKKNKRECSPAKISELLKFGTDVEILLRTSVVQGIHKDSDTLVLQARKDLLLDNIPFCDAPEKQT

lyrm7

Complex III assembly factor LYRM7

104 amino acids

Assembly factor required for Rieske Fe-S protein UQCRFS1 incorporation into the cytochrome b-c1 (CIII) complex. Functions as a chaperone, binding to this subunit within the mitochondrial matrix and stabilizing it prior to its translocation and insertion into the late CIII dimeric intermediate within the mitochondrial inner membrane (By similarity).

Belongs to the complex I LYR family.

12.018 kDa

MDSRMKVLKLFKTLHRTRQCVFQNDCRALEAARRRINEEFKKNKSECSPAKISELLKFGTDVEIVLRTSVVQGIHTDSNKLVLQARKDLLLDNIPFCDAPEKQT