About Services Proteins Contact

LCR26

Gene
LCR26
Protein
Putative defensin-like protein 160
Organism
Arabidopsis thaliana
Length
77 amino acids
Similarity
Belongs to the DEFL family.
Mass
8.555 kDa
Sequence
MAKLSCSYFFILMLVFSALLMVECDEGKRCHTTIDKGNFCDLVDCRLSCFSGYNGVGKCFDDPKVPGRSNCGCLYNC