About Services Proteins Contact

LCNL1

Gene
LCNL1
Protein
Lipocalin-like 1 protein
Organism
Homo sapiens
Length
164 amino acids
Similarity
Belongs to the calycin superfamily. Lipocalin family.
Mass
17.784 kDa
Sequence
MVGVVSDDQDFLDSKDTMKMAVVLVTPLGNGDLALKFGYPTPHGGCQKMDTTFTEGAVPGQFSNPAMALSDIRVAFSDYQHFALLYLEMRKGGLRNQWLQLYGGRAAGRRPRHPRFGSGMSPLCLHQPFLHAEGGTAGSWCLWPRVPAPPCPSLPLFAPPAPSL