About Services Proteins Contact

LCE3E

Gene
LCE3E
Protein
Late cornified envelope protein 3E
Organism
Homo sapiens
Length
92 amino acids
Function
Precursors of the cornified envelope of the stratum corneum.
Similarity
Belongs to the LCE family.
Mass
9.507 kDa
Sequence
MSCQQNQKQCQPPPKCPSPKCPPKNPVQCLPPASSGCAPSSGGCGPSSEGGCFLNHHRRHHRCRRQRSNSCDRGSGQQGGGSGCCHGSGGCC