About Services Proteins Contact

LCE1B

Gene
LCE1B
Protein
Late cornified envelope protein 1B
Organism
Homo sapiens
Length
118 amino acids
Function
Precursors of the cornified envelope of the stratum corneum.
Similarity
Belongs to the LCE family.
Mass
11.626 kDa
Sequence
MSCQQNQQQCQPPPKCIPKCPPKCLTPRCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSCGSSSGGCCSSGGGGCCLSHHRRRRSHCHRPQSSGCCSQPSGGSSCCGGGSGQHSGGCC