About Services Proteins Contact

LBD25

Gene
LBD25
Protein
LOB domain-containing protein 25
Organism
Arabidopsis thaliana
Length
159 amino acids
Similarity
Belongs to the LOB domain-containing protein family.
Mass
17.749 kDa
Sequence
MPKRETKKIKPSQEVIKEGPFLVAIHLKGIYMSNYTNSPCAACKFLRRKCTSDCVFAPYFPPEEPTKFANVHRIFGASNVSKILHEVAPHQREDAVNSLAYEAEARLKDPVYGCVGAISVLQRQVLRLQRELEETNADLMRYAGCLGGETTSAYGGRRG