LAMTOR3

Ragulator complex protein LAMTOR3

124 amino acids

As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2 (By similarity).

Belongs to the LAMTOR3 family.

13.65 kDa

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSNANTGLIVSLEKELAPLFEELRQVVEVS

LAMTOR3

Ragulator complex protein LAMTOR3

124 amino acids

Regulator of the TOR pathway, a signaling cascade that promotes cell growth in response to growth factors, energy levels, and amino acids. As part of the Ragulator complex, may activate the TOR signaling cascade in response to amino acids. Adapter protein that may regulate the MAP kinase cascade (By similarity).

Belongs to the LAMTOR3 family.

13.68 kDa

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSNANTGLIVSLEKELTPLFEELRQVVEVS

lamtor3

Ragulator complex protein LAMTOR3

124 amino acids

Regulator of the TOR pathway, a signaling cascade that promotes cell growth in response to growth factors, energy levels, and amino acids. As part of the Ragulator complex, may activate the TOR signaling cascade in response to amino acids. Adapter protein that may regulate the MAP kinase cascade (By similarity).

Belongs to the LAMTOR3 family.

13.677 kDa

MADNLRSYLYKQLPSVEGLHAIVVTDRDGAPVIKVANDNAPEYALRPAFLSTFALATDQGSKLGLSKNKSIICYYSTYQIVQFNRLPLVISFIASSNANTGLIFSLEKELVPLIEELRQVVEVA

LAMTOR3

Ragulator complex protein LAMTOR3

124 amino acids

As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2.

Belongs to the LAMTOR3 family.

13.623 kDa

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS

Lamtor3

Ragulator complex protein LAMTOR3

124 amino acids

As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2.

Belongs to the LAMTOR3 family.

13.553 kDa

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDSAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELIKVVEVS

lamtor3

Ragulator complex protein LAMTOR3

124 amino acids

Regulator of the TOR pathway, a signaling cascade that promotes cell growth in response to growth factors, energy levels, and amino acids. As part of the Ragulator complex, may activate the TOR signaling cascade in response to amino acids. Adapter protein that may regulate the MAP kinase cascade (By similarity).

Belongs to the LAMTOR3 family.

13.721 kDa

MADDLKRYLYKQLQSVEGLHAIVVTDRDGVPVIKVANDNAPVHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQIVQFNRLPLVISFIASSNANTGLIMSLEKELAPLIEELRQVVEVT

LAMTOR3

Ragulator complex protein LAMTOR3

124 amino acids

As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2 (By similarity).

Belongs to the LAMTOR3 family.

13.639 kDa

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSTICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRRVVEVS

Lamtor3

Ragulator complex protein LAMTOR3

124 amino acids

As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2 (By similarity).

Belongs to the LAMTOR3 family.

13.58 kDa

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDSAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSNANTGLIVSLEKELAPLFEELIKVVEVS

LAMTOR3

Ragulator complex protein LAMTOR3

124 amino acids

Regulator of the TOR pathway, a signaling cascade that promotes cell growth in response to growth factors, energy levels, and amino acids. As part of the Ragulator complex, may activate the TOR signaling cascade in response to amino acids. Adapter protein that may regulate the MAP kinase cascade (By similarity).

Belongs to the LAMTOR3 family.

13.68 kDa

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSNANTGLIVSLEKELTPLFEELRQVVEVS

lamtor3

Ragulator complex protein LAMTOR3

124 amino acids

Regulator of the TOR pathway, a signaling cascade that promotes cell growth in response to growth factors, energy levels, and amino acids. As part of the Ragulator complex, may activate the TOR signaling cascade in response to amino acids. Adapter protein that may regulate the MAP kinase cascade (By similarity).

Belongs to the LAMTOR3 family.

13.681 kDa

MADDLKRYLYKQLQSVEGLHAIVVTDRDGVPVVKVANDNAPVPALRPGFLSTFALATDQGSKLGLSKNKSIICYYNDYQIVQFNRLPLVISFIARSSANTGLIMSLENELAPLIEELKQVVEVT

lamtor3

Ragulator complex protein LAMTOR3

124 amino acids

Regulator of the TOR pathway, a signaling cascade that promotes cell growth in response to growth factors, energy levels, and amino acids. As part of the Ragulator complex, may activate the TOR signaling cascade in response to amino acids. Adapter protein that may regulate the MAP kinase cascade (By similarity).

Belongs to the LAMTOR3 family.

13.761 kDa

MAEELRRFLYKKLTSVDELHAIVVSDRDGVPVIKVANENAPEHALRPAFLSTFALATDQGSKLGLSKNKSIICYYSTYQVVQFNQLPLVVSFIASCNANTGLILSLEEELGSLFKELRQVVEIS