Lalba

Alpha-lactalbumin

159 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

17.85 kDa

MMRFVPLFLACISLPAFQATEFTKCEVSHAIEDMDGYQGISLLEWTCVLFHTSGYDSQAIVKNNGSTEYGLFQISNRNWCKSSEFPESENICDISCDKFLDDELADDIVCAKKIVAIKGIDYWKAHKPMCSEKLEQWRCEKPGAPALVVPALNSETPVP

Lalba

Alpha-lactalbumin

143 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

16.26 kDa

MMHFVPLFLVCILSLPAFQATELTKCKVSHAIKDIDGYQGISLLEWACVLFHTSGYDTQAVVNDNGSTEYGLFQISDRFWCKSSEFPESENICGISCDKLLDDELDDDIACAKKILAIKGIDYWKAYKPMCSEKLEQWRCEKP

LALBA

Alpha-lactalbumin

142 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

16.248 kDa

MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSDICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL

LALBA

Alpha-lactalbumin

142 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

16.247 kDa

MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL

LALBA

Alpha-lactalbumin

142 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

16.275 kDa

MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKDYGGVSLPEWVCTAFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL

LALBA

Alpha-lactalbumin

142 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

16.285 kDa

MMSFVSLLLVSILFPAIQAKQFTKCELPQVLKDMDGFGGIALPEWICTIFHTSGYDTQTIVNNNGGTDYGLFQISNKFWCKDDQNLQSRNICDISCDKFLDDDLTDDMICAKKILDKEGIDYWLAHKPLCSEKLEQWRCEKL

LALBA

Alpha-lactalbumin

142 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

16.255 kDa

MMSFVSLLLVGILFHATQAEQLTKCEVFQKLKDLKDYGGVSLPEWVCTAFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSRNICNISCDKFLDDDLTDDIVCAKKILDKVGINYWLAHKALCSEKLDQWLCEKL

LALBA

Alpha-lactalbumin

142 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

16.248 kDa

MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSDICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL

LALBA

Alpha-lactalbumin

142 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

16.247 kDa

MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL

LALBA

Alpha-lactalbumin

142 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

16.275 kDa

MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKDYGGVSLPEWVCTAFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL

LALBA

Alpha-lactalbumin

142 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

16.285 kDa

MMSFVSLLLVSILFPAIQAKQFTKCELPQVLKDMDGFGGIALPEWICTIFHTSGYDTQTIVNNNGGTDYGLFQISNKFWCKDDQNLQSRNICDISCDKFLDDDLTDDMICAKKILDKEGIDYWLAHKPLCSEKLEQWRCEKL

LALBA

Alpha-lactalbumin

142 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

16.255 kDa

MMSFVSLLLVGILFHATQAEQLTKCEVFQKLKDLKDYGGVSLPEWVCTAFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSRNICNISCDKFLDDDLTDDIVCAKKILDKVGINYWLAHKALCSEKLDQWLCEKL

LALBA

Alpha-lactalbumin

142 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

16.3 kDa

MMSFFPLLLVGILFPAVQAKQLTKCALSHELNDLAGYRDITLPEWLCIIFHISGYDTQAIVKNSDHKEYGLFQINDKDFCESSTTVQSRNICDISCDKLLDDDLTDDIMCVKKILDIKGIDYWLAHKPLCSDKLEQWYCEAQ

LALBA

Alpha-lactalbumin

142 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

16.225 kDa

MRFFVPLFLVGILFPAILAKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

LALBA

Alpha-lactalbumin

142 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

16.316 kDa

MMSFVSLLLVGILFHATQAEQLTKCEVFQELKDLKDYGGVSLPEWVCTAFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSRNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL

LALBA

Alpha-lactalbumin

141 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

16.174 kDa

MMSFVSLLVVGILFPAIQAKQFTKCELSQVLKDMDGYGDITLPEWICTIFHISGYDTKTIVHDNGSTEYGLFQINNKLWCRDNQIQSKNICGISCDKFLDDDLTDDMMCAKKILDNEGIDYWLAHKALCSEKLDQWLCEKM

LALBA

Alpha-lactalbumin

141 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

16.082 kDa

MMPLVPLLLVSIVFPGIQATQLTRCELTEKLKELDGYRDISMSEWICTLFHTSGLDTKITVNNNGSTEYGIFQISDKLWCVSKQNPQSKNICDTPCENFLDDNLTDDVKCAMKILDKEGIDHWLAHKPLCSENLEQWVCKK

LALBA

Alpha-lactalbumin

140 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

15.722 kDa

MMSLLSLLLLGIALPATQAIDYRKCQASQILKEHGMDKVIPLPELVCTMFHISGLSTQAEVNNHSNKEYGIFQISNNGWCAEKQEDVANSVCGILCSKFLDDDITDDIECAKKILQLPEGLGYWKAHETFCIEDLDQWRC

LALBA

Alpha-lactalbumin

140 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

15.957 kDa

MMSLLPLLLIGIVLPATQAKDYGKCELNQILRERGVDKVISLPELICTMFHSSGFSTETEVDNNNHKEYGIFQISSNGWCAEKQEDVERSVCGILCSKLLDDDITDDIVCAKKILQLPERLDHWKAHNTFCRENLDQWNC

LALBA

Alpha-lactalbumin

126 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

14.337 kDa

RIFQICELSRVLKENGLGGFHGVSLEEWLCVIFHESGYDSQALNYYNGSSSHGLFQINQPYWCDDXDSESTEPSVNACQIPCSKLLDDDILDDIECAKKIVKEPKGITAWEAWQPFCNSDLDQWKC

LALBA

Alpha-lactalbumin

126 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

14.41 kDa

KVFEKCELSQMLKANGLDGFQGITLEEWICIAFHESGFDSRALNYYNGSSSHGLFQINRQYWCDGQDAKSTEPSVNACQISCDKLRDDDIEDDIKCVKKILKESQGITAWEAWQPFCIADLDQWKC

LALBA

Alpha-lactalbumin

123 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

14.43 kDa

KQFTKCKLSDELKDMNGHGGITLAEWICIIFHMSGYDTETVVSNNGNREYGLFQINNKIWCRDNENLQSRNICDISCDKFLDDDLTDDKMCAKKILDKEGIDYWLAHKPLCSEKLEQWQCEKW

LALBA

Alpha-lactalbumin

123 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

14.43 kDa

KQFTKCKLSDELKDMNGHGGITLAEWICIIFHMSGYDTETVVSNNGNREYGLFQINNKIWCRDNENLQSRNICDISCDKFLDDDLTDDKMCAKKILDKEGIDYWLAHKPLCSEKLEQWQCEKW

LALBA

Alpha-lactalbumin

123 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

14.222 kDa

KQFTKCELSQVLKSMDGYKGVTLPEWICTIFHSSGYDTQTIVKNNGKTEYGLFQINNKMWCRDNQILPSRNICGISCNKFLDDDLTDDVMCAKKILDSEGIDYWLAHKPLCSEKLEQWLCEEL

LALBA

Alpha-lactalbumin

123 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

14.174 kDa

KQFTKCELSQNLYDIDGYGRIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNALWCKSSQSPQSRNICDITCDKFLDDDITDDIMCAKKILDIKGIDYWIAHKALCTEKLEQWLCEKE

LALBA

Alpha-lactalbumin

121 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

13.785 kDa

IDYRKCQASQILKEHGMDKVIPLPELVCTMFHISGLSTQAEVNNHSNKEYGIFQISNDGWCAEKQEDVANSVCGILCSKFLDDDITDDIECAKKILQLPEGLGYWKAHETFCLEDLDQWRC

LALBA

Alpha-lactalbumin I

42 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

4.727 kDa

single

IDYRKCQASQILKEHGMDKVIPLPELVCTMFHISGLSPQAEV

LALBA

Alpha-lactalbumin

24 amino acids

Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.

Belongs to the glycosyl hydrolase 22 family.

2.642 kDa

single

KQFTKCELSQVLKDMDGYGGIALP