Function
Transcriptional repressor (PubMed:23888064, PubMed:24806884). Direct regulator of the transcription of peroxidase (Prxs) and reactive oxygen species (ROS)-related genes via the recognition of 5'-ATCACA-3' motif (PubMed:24806884). Binds to 5'-TATCCA-3' motif (TA box) and represses the activity of corresponding promoters (e.g. sugar response genes) (PubMed:25920996). Regulates hypocotyl elongation in response to darkness by enhancing auxin accumulation in a phytochrome-interacting factor (PIF) proteins-dependent manner. Promotes lateral roots formation (PubMed:23888064). Promotes cell expansion during leaves development via the modulation of cell wall-located Prxs (PubMed:24806884). Plays a critical role in developmentally regulated and dark-induced onset of leaf senescence by repressing the transcription of several genes involved in chloroplast function and responses to light and auxin. Promotes responses to auxin, abscisic acid (ABA), and ethylene (PubMed:25920996).
Sequence
MTRRCSHCNHNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHYTGSGSGGHGTGSNTPGSPGDVPDHVAGDGYASEDFVAGSSSSRERKKGTPWTEEEHRMFLLGLQKLGKGDWRGISRNYVTTRTPTQVASHAQKYFIRQSNVSRRKRRSSLFDMVPDEVGDIPMDLQEPEEDNIPVETEMQGADSIHQTLAPSSLHAPSILEIEECESMDSTNSTTGEPTATAAAASSSSRLEETTQLQSQLQPQPQLPGSFPILYPTYFSPYYPFPFPIWPAGYVPEPPKKEETHEILRPTAVHSKAPINVDELLGMSKLSLAESNKHGESDQSLSLKLGGGSSSRQSAFHPNPSSDSSDIKSVIHAL