KRTAP8-1

Keratin-associated protein 8-1

63 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the KRTAP type 8 family.

6.826 kDa

MLCDNFPGAVFPGCYWGSYGYPLGYSVGCGYGSTYSPVGYGFGYGYNGCGAFGYRRYSPFALY

KRTAP8-1

Keratin-associated protein 8-1

62 amino acids

In the wool cortex, wool keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant wool shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of wool keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the KRTAP type 8 family.

6.791 kDa

MSYCFSSTVFPGCYWGSYGYPLGYSVGCGYGSTYSPVGYGFGYGYNGSGAFGCRRFWPFALY

Krtap8-1

Keratin-associated protein 8-1

61 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the KRTAP type 8 family.

6.697 kDa

MYYTGAEGSVFPGCYWGSYGYPLGYSVGCGYGSTYSPVGYGLGYGYNGCGAYRRYWPFALY