KRS

Stigma-specific STIG1-like protein 4

174 amino acids

Endosperm-specific cysteine-rich protein that acts downstream of BHLH95/ZOU to modify the interface between embryo and endosperm and mediate the separation of these two tissues during seed development. Necessary for the biogenesis of the embryo sheath, an extracuticular endosperm-derived structure at the surface of the embryo. Required for the separation of embryo and endosperm, and for normal progression of the embryo through the endosperm tissue. Required for the formation of a normal embryonic cuticle.

Belongs to the STIG1 family.

19.531 kDa

MMSIKLTLCALIFFLLNSLLHHVLGHDNQLNTTSSWLKSHIKAATTTNWGRPKPPMCKPWICKRSGPSEARMRCCRNQCVDVLSDPNHCRFCFKSCRFALSCCDGDCVDTNTDPSNCGQCGNECESGAPCEFGMCGYAAPSSQPGKRHRRHKFHRPRPPPSPDSKLNYDDHDDE