JPT1

Jupiter microtubule associated homolog 1

154 amino acids

Modulates negatively AKT-mediated GSK3B signaling. Induces CTNNB1 'Ser-33' phosphorylation and degradation through the suppression of the inhibitory 'Ser-9' phosphorylation of GSK3B, which represses the function of the APC:CTNNB1:GSK3B complex and the interaction with CDH1/E-cadherin in adherent junctions. Plays a role in the regulation of cell cycle and cell adhesion. Has an inhibitory role on AR-signaling pathway through the induction of receptor proteosomal degradation.

Belongs to the JUPITER family.

16.01 kDa

MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRRNKMASSIFGTPEENPPSWAKSAGAKSSGGREDAESSGPQRRNSSEANSGDFLDLKGEGDVHENVDTDLQASLGQSEEKPVPAAPVPSPVAPAPVPSRRNPPGGKSSLVLG

JPT1

Jupiter microtubule associated homolog 1

154 amino acids

Modulates negatively AKT-mediated GSK3B signaling (PubMed:21323578, PubMed:22155408). Induces CTNNB1 'Ser-33' phosphorylation and degradation through the suppression of the inhibitory 'Ser-9' phosphorylation of GSK3B, which represses the function of the APC:CTNNB1:GSK3B complex and the interaction with CDH1/E-cadherin in adherent junctions (PubMed:25169422). Plays a role in the regulation of cell cycle and cell adhesion (PubMed:25169422, PubMed:25450365). Has an inhibitory role on AR-signaling pathway through the induction of receptor proteosomal degradation (PubMed:22155408).

Belongs to the JUPITER family.

16.015 kDa

MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEENQASWAKSAGAKSSGGREDLESSGLQRRNSSEASSGDFLDLKGEGDIHENVDTDLPGSLGQSEEKPVPAAPVPSPVAPAPVPSRRNPPGGKSSLVLG

Jpt1

Jupiter microtubule associated homolog 1

154 amino acids

Modulates negatively AKT-mediated GSK3B signaling. Induces CTNNB1 'Ser-33' phosphorylation and degradation through the suppression of the inhibitory 'Ser-9' phosphorylation of GSK3B, which represses the function of the APC:CTNNB1:GSK3B complex and the interaction with CDH1/E-cadherin in adherent junctions (By similarity). Plays a role in the regulation of cell cycle and cell adhesion (PubMed:25450365). Has an inhibitory role on AR-signaling pathway through the induction of receptor proteosomal degradation (By similarity).

Belongs to the JUPITER family.

16.081 kDa

MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPAEQPVRKNKMASNIFGTPEENPPSWAKSAGSKSSGGREDSESPGTQRSNSSEASSGDFLDLKGEGDMHENVDTDFQANLAQMEEKPVPAAPVPSPVAPAPVPSRRNPPGGKSSLVLG

JPT1

Jupiter microtubule associated homolog 1

149 amino acids

Modulates negatively AKT-mediated GSK3B signaling. Induces CTNNB1 'Ser-33' phosphorylation and degradation through the suppression of the inhibitory 'Ser-9' phosphorylation of GSK3B, which represses the function of the APC:CTNNB1:GSK3B complex and the interaction with CDH1/E-cadherin in adherent junctions. Plays a role in the regulation of cell cycle and cell adhesion. Has an inhibitory role on AR-signaling pathway through the induction of receptor proteosomal degradation.

Belongs to the JUPITER family.

15.575 kDa

MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEENPPSWAKSAGGREDSESPGTQRSNSSEASSGDFLDLKGESDVHENVDTDFQASLAQVEEKPVPAAPVPSPVAPAPAPSRRNPPGGKSSLVLG