IGFBP2

Insulin-like growth factor-binding protein 2

325 amino acids

Inhibits IGF-mediated growth and developmental rates. IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.

34.814 kDa

MLPRVGCPALPLPPPPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGPPPVAPPAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSELPLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPTIRGDPECHLFYNEQQEARGVHTQRMQ

IGFBP2

Insulin-like growth factor-binding protein 2

317 amino acids

Inhibits IGF-mediated growth and developmental rates (By similarity). IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.

34.015 kDa

MQPRLGGPALLLLPPLLLLLLLGAGGGDCGARAEVLFRCPPCTPESLAACKPPPGAAAGPAGDARVPCELVREPGCGCCSVCARLEGERCGVYTPRCGQGLRCYPNPGSELPLRALVHGEGTCEKHGDAEYSASPEQVADNGEEHSEGGLVENHVDGNVNLMGGGGGAGRKPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPTIRGDPECHLFYNEQQGARGVHTQRMQ

IGFBP2

Insulin-like growth factor-binding protein 2

317 amino acids

Inhibits IGF-mediated growth and developmental rates (By similarity). IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.

34.189 kDa

MQPRLGGPALLLLPPLLLLLLLGAGGGDCGARAEVLFRCPPCTPESLAACKPPPGAAAGPAGDARVPCELVREPGCGCCSVCARLEGERCGVYTPRCGQGLRCYPNPGSELPLRALVHGEGTCEKHGDAEYSASPEQVADNGEEHSEGGQVENHVDGNVNLMGGGGGAGRKPLKFRMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPTIRGDPECHLFYNEQQGARGVHTQRMQ

IGFBP2

Insulin-like growth factor-binding protein 2

316 amino acids

May have both growth-inhibiting and growth-promoting effects, depending on tissue type; increases IGF-induced DNA synthesis in the uterine epithelium. IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.

33.937 kDa

MLPRLGGTALSLLPLLLLLLGTGGRGARAEVLFRCPPCTPESLAACRPPPAAPPSAGAGPAGDSRAPCELVREPGCGCCSVCARLEGERCGVYTPRCAQGLRCYPHPGSELPLQALVLGEGTCEKRRDAEYGASPEQVADNGDDAEGGLVENHVDGNVNLLGGTGGAGRKPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPTIRGDPECHLFYNEQQGARGAHTQRMQ

IGFBP2

Insulin-like growth factor-binding protein 2

311 amino acids

Inhibits IGF-mediated growth and developmental rates (By similarity). IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.

33.538 kDa

MALGGVGRGGAARAAWPRLLLAALAPALALAGPALPEVLFRCPPCTAERLAACSPAARPPCPELVREPGCGCCPVCARLEDEACGVYTPRCAAGLRCYPDPGAELPPQALVQGQGTCARPPDTDEYGASTEPPADNGDDRSESILAENHVDSTGGMMSGASSRKPLKTGMKEMPVMREKVNEQQRQMGKVGKAHHNHEDSKKSRMPTGRTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSVNGQRGECWCVDPIHGKVIQGAPTIRGDPECHLFYTAHEQEDRGAHALRSQ

Igfbp2

Insulin-like growth factor-binding protein 2

305 amino acids

Inhibits IGF-mediated growth and developmental rates (By similarity). IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.

32.847 kDa

MLPRLGGPALPLLLPSLLLLLLLGAGGCGPGVRAEVLFRCPPCTPERLAACGPPPDAPCAELVREPGCGCCSVCARQEGEACGVYIPRCAQTLRCYPNPGSELPLKALVTGAGTCEKRRVGTTPQQVADSDDDHSEGGLVENHVDGTMNMLGGGSSAGRKPLKSGMKELAVFREKVNEQHRQMGKGAKHLSLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDDRGPLEHLYSLHIPNCDKHGRYNLKQCKMSLNGQRGECWCVNPNTGKPIQGAPTIRGDPECHLFYNEQQETGGAHAQSVQ

Igfbp2

Insulin-like growth factor-binding protein 2

304 amino acids

Inhibits IGF-mediated growth and developmental rates (By similarity). IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.

32.855 kDa

MLPRLGGPALPLLLPSLLLLLLLGAGGCGPGVRAEVLFRCPPCTPERLAACGPPPDAPCAELVREPGCGCCSVCARQEGEACGVYIPRCAQTLRCYPNPGSELPLKALVTGAGTCEKRRVGATPQQVADSEDDHSEGGLVENHVDGTMNMLGGSSAGRKPPKSGMKELAVFREKVNEQHRQMGKGAKHLSLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDDRGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKPIQGAPTIRGDPECHLFYNEQQENDGAHAQRVQ

igfbp2

Insulin-like growth factor-binding protein 2

284 amino acids

IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors (By similarity).

30.891 kDa

MGLSRYLLGLLLGVLCTPAPAEVLFRCPPCSPERLATCPGSAPRPPCAELVRAPGCGCCPVCARLEGESCGVYTARCAGGLRCYPHPGSELPLQALVLGLGTCGKRRDTEYGSSQERGTELPEERSDNMLVDNKLEAGPAVAGEAAPRKPSKKEMKEIAVTRERANEQQRSKSNKSEDKKRPARSLCQLQLDQVLERISGMHLPDDRGPLEHLYALHIPNCDKNGFFNLKQCKMSVNGQRGECWCVNPITGKALPGSPTIRGDPECHLYYTSPEEGRAHTQRAP

igfbp2

Insulin-like growth factor-binding protein 2

281 amino acids

IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors (By similarity).

30.592 kDa

MVLSEHLLVLLGAVLCAPALSDVLFRCPPCSPERLAACPGNSPRSPCAELVRAPGCGCCPVCARLEGESCGVYTARCAGGLRCYPHPGSELPLQALVLGLGTCGKRRDAEYGSSQERGTELPEDQSDNMLVDNNLVAGPAVPGDFMPRKSSKAHAVNRERANEQHRSKTNKSEDKKRPARSLCQLQLDQVLERISGMHLPDDRGPLEHLYALPIPNCDKNGFFNLKQCKMSVNGQRGECWCVNPITGKVLPGSPTVRGDPECHLFYTNPEEERRAHTQRAP

igfbp2

Insulin-like growth factor-binding protein 2

20 amino acids

Inhibits IGF-mediated growth and developmental rates (By similarity). IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.

2.287 kDa

single

DLVFYCPKCTAERQTACPKL