About Services Proteins Contact

IFNAD

Gene
IFNAD
Protein
Interferon alpha-D
Organism
Bos taurus
Length
189 amino acids
Function
Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Similarity
Belongs to the alpha/beta interferon family.
Mass
21.318 kDa
Sequence
MAPAWSLLLALLLLSCNAICSLGCHLPHSHSLAKRRVLTLLRQLRRVSPSSCLQDRNDFAFPQEALGGSQLQKAQAISVLHEVTQHTFQLSSTEGSAAVWDESLLDKLRTALDQQLTDLQACLRQEEGLPGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAQVMRAFSSSTNLQERFRRKD