About Services Proteins Contact

IFITM10

Gene
IFITM10
Protein
Interferon-induced transmembrane protein 10
Organism
Homo sapiens
Length
228 amino acids
Similarity
Belongs to the CD225/Dispanin family.
Mass
24.599 kDa
Sequence
MREGKRGPPCILSFRGTLERVEAQWELEAQGPGQCPAPLGDPASTTDGAQEARVPLDGAFWIPRPPAGSPKGCFACVSKPPALQAPAAPAPEPSASPPMAPTLFPMESKSSKTDSVRAAGAPPACKHLAEKKTMTNPTTVIEVYPDTTEVNDYYLWSIFNFVYLNFCCLGFIALAYSLKVRDKKLLNDLNGAVEDAKTARLFNITSSALAASCIILVFIFLRYPLTDY

Gene
Ifitm10
Protein
Interferon-induced transmembrane protein 10
Organism
Mus musculus
Length
201 amino acids
Similarity
Belongs to the CD225/Dispanin family.
Mass
21.555 kDa
Sequence
MAQGPSQCPALLGAPASTTDGTQEARVPLDGAFWIPRPPAGSPKGCFACVSKPPALQAAAAPAPEPSASPPMAPTLFPMESKSSKTDSVRASGVPQACKHLAEKKTMTNPTTVIEVYPDTTEVNDYYLWSIFNFVYLNFCCLGFIALAYSLKVRDKKLLNDLNGAVEDAKTARLFNITSSALAASCIILIFIFLRYPLTDY