Hsp83

Heat shock protein 83

720 amino acids

Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function. Required for piRNA biogenesis by facilitating loading of piRNAs into PIWI proteins (By similarity).

Belongs to the heat shock protein 90 family.

82.087 kDa

MPEPQEGETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLESGKELFIKIIPNKEAGTLTLIDTGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVVVTSKNNDDEQYVWESSAGGSFTVRPDSGEPLGRGTKIVLHIKEDQLEYLEESKIKQIVNKHSQFIGYPIKLLVEKEREKEVSDDEAEEEKKEEKEEKKDDEPKLEDAEDDEDKKDKKKKTVKVKYTEDEELNKTKPIWTRNADDISQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLDFRALLFVPRRMPFDLFENKKKKNNIKLYVRRVFIMDNCEELIPDYLNFIKGVVDSEDLPLNISREMLQQNKILKVIRKNLVKKCLELFEELAEDKETYKKFYDQFSKNLKLGVHEDSQNRQKLADLLRFNTSASGDEYCSLNDYVGRMKENQTQIYFITGESIDQVKNSAFVERVKKRGFEVIYMTEPIDEYVIQQLKEYKGKQLVSVTKEGLELPEDEAEKKKREEDKAKFENLCKVMKSVLESKVEKVMVSNRLVDSPCCIVTSQYGWSANMERIMKAQALRDSSAMGYMAGKKHLEINPDHAIIETLRQRAEADKNDKAVKDLVILLFETALLSSGFSLDEPGTHASRIYRMIKLGLGIDEDEPMTTEESSSGAAAAAPASGDAPPLVDDSEDLSHMEEVD

Hsp83

Heat shock protein 83

717 amino acids

Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function. Together with Hop and piwi, mediates canalization, also known as developmental robustness, likely via epigenetic silencing of existing genetic variants and suppression of transposon-induced new genetic variation. Required for piRNA biogenesis by facilitating loading of piRNAs into PIWI proteins.

Belongs to the heat shock protein 90 family.

81.865 kDa

MPEEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVTSKNNDDEQYVWESSAGGSFTVRADNSEPLGRGTKIVLYIKEDQTDYLEESKIKEIVNKHSQFIGYPIKLLVEKEREKEVSDDEADDEKKEGDEKKEMETDEPKIEDVGEDEDADKKDKDAKKKKTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRTPFDLFENQKKRNNIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPLNISREMLQQNKVLKVIRKNLVKKTMELIEELTEDKENYKKFYDQFSKNLKLGVHEDSNNRAKLADFLRFHTSASGDDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLKEYKGKQLVSVTKEGLELPEDESEKKKREEDKAKFESLCKLMKSILDNKVEKVVVSNRLVDSPCCIVTSQFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVETLRQKADADKNDKAVKDLVILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPMTTDDAQSAGDAPSLVEDTEDASHMEEVD

Hsp83

Heat shock protein 83

717 amino acids

Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function. Required for piRNA biogenesis by facilitating loading of piRNAs into PIWI proteins (By similarity).

Belongs to the heat shock protein 90 family.

81.771 kDa

MPEEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLIADRVTVTSKNNDDEQYVWESSAGGSFTVKADNSEPLGRGTKIVLYIKEDQTDYLEESKIKEIVNKHSQFIGYPIKLLVEKEREKEVSDDEADDEKKDDEAKKDMDTDEPKIEDVGEDEDADKKDKDGKKKKTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLCVKHFSVEGQLEFRALLFIPRRTPFDLFENQKKRNNIKLYVRRVFIMDNCEDLIPEYLNFIKGVVDSEDLPLNISREMLQQNKVLKVIRKNLVKKTMELIEELTEDKENYKKFYEQFSKNLKLGVHEDSNNRAKLADFLRFHTSASGDDFCSLSDYVSRMKENQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLKEYKGKQLVSVTKEGLELPEDEAEKKKREEDKAKFEGLCKLMKSILDSKVEKVVVSNRLVDSPCCIVTSQFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVEALRQKADADKNDKAVKDLVILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPMTTEDAHSGGDAPGLVEDTEDASHMEEVD

Hsp83

Heat shock protein 83

716 amino acids

Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function (By similarity). Required for piRNA biogenesis by facilitating loading of piRNAs into PIWI proteins.

Belongs to the heat shock protein 90 family.

82.422 kDa

MPEEMETQPAEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELYIKIIPNKNEGTLTIIDTGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSSYLVADRVTVHSKHNDDEQYVWESSAGGSFTVRPDSGEPLGRGTKIVLHVKEDLAEFMEEHKIKEIVKKHSQFIGYPIKLMVEKEREKELSDDEAEEEKKEEEDEKPKIEDVGEDEDEDKKDTKKKKKTIKEKYTEDEELNKTKPIWTRNADDITQDEYGDFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENKKRKNNIKLYVRRVFIMDNCEDLIPEYLNFIRGVVDSEDLPLNISREMLQQNKILKVIRKNLVKKCLELFEELAEDKENYKKYYEQFSKNLKLGIHEDSQNRAKLSELLRYHTSASGDEACSLKEYVSRMKENQKHIYYITGENRDQVANSSFVERVKKRGYEVVYMTEPIDEYVVQQMREYDGKTLVSVTKEGLELPEDEEEKKKREEDKVKFEGLCKVMKNILDNKVEKVVVSNRLVESPCCIVTAQYGWSANMERIMKAQALRDTSTMGYMAAKKHLEINPDHSIVETLRQKAEADKNDKAVKDLVILLYETALLSSGFTLDEPQVHASRIYRMIKLGLGIDEDEPIQVEEPASGDVPPLEGDADDASRMEEVD

Hsp83

Heat shock protein 83

716 amino acids

Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function. Required for piRNA biogenesis by facilitating loading of piRNAs into PIWI proteins (By similarity).

Belongs to the heat shock protein 90 family.

81.76 kDa

MPEEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVTSKNNDDEQYIWESSAGGSFTVRADNSEPLGRGTKIVLYIKEDQTDYLEESKIKEIVNKHSQFIGYPIKLLVEKEREKEVSDDEADDDKKEDEKKEMDTDEPKIEDVGEDEDADKKDKDAKKKKTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRTPFDLFENQKKRNNIKLYVRRVFIMDNCEDLIPEYLNFIKGVVDSEDLPLNISREMLQQNKVLKVIRKNLVKKTMELIEELTEDKENYKKFYDQFSKNLKLGVHEDSNNRAKLADFLRFHTSASGDDFCSLSDYVSRMKENQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLKEYKGKQLVSVTKEGLELPEDDAEKKKREEDKAKFESLCKLMNAILDNKVEKVVVSNRLVDSPCCIVTSQFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVETLRQKADADKNDKAVKDLVILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPMTTEDAQSAGDAPSLVEDTEDASHMEEVD

HSP83

Heat shock protein 83

703 amino acids

Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function (By similarity).

Belongs to the heat shock protein 90 family.

80.716 kDa

MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNSSDACDKIRYQSLTNQSVLGDEPHLRIRVIPDRVNKTLTVEDSGIGMTKADLVNNLGTIARSGTKSFMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVVSKNNEDDAYTWESSAGGTFTVTSTPDCDLKRGTRIVLHLKEDQQEYLEERRLKDLIKKHSEFIGYDIELMVENTTEKEVTDEDEDEEAAKKAEEGEEPKVEEVKDGVDADAKKKKTKKVKEVKQEFVVQNKHKPLWTRDPKDVTKEEYASFYKAISNDWEEQLSTKHFSVEGQLEFRAILFLPKRAPFDMFEPNKKRNNIKLYVRRVFIMDNCEDLCPEWLGFLRGVVDSEDLPLNISRENLQQNKILKVIRKNIVKKALELFEELAGNKEDYKKFYEQFSKNVKLGIHEDSTNRKKLMELLRFHSSESGEEMTTLKDYVTRMKEGQKCIYYVTGDSKKKLETSPFIEQARRRGMEVLFMTDPIDEYVMQQVKDFEDKKFACLTKEGVHFEETEEEKKQREEEKASYERLCKAMKEVLGDKVEKVVVSDRLATSPCILVTSEFGWSAHMEQIMRNQALRDSSMSAYMMRKKTMEINTTHAIVKELKRRVEADENDKAAKDLIFLLFDTSLLTSGFTLDDPTAYADRIHRMIKLGLSLDDDAEEEEAQAPVAAAANSSTGASGMEEVD

HSP83

Heat shock protein 83

701 amino acids

Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function (By similarity).

Belongs to the heat shock protein 90 family.

80.585 kDa

MTETFAFQAEINQLMSLIINTFYSNKEIFLRDVISNASDACDKIRYQSLTDPSVLGDATRLCVRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKAFMEALEAGADMSMIGQFGVGFYSAYLVADRVTVTSKNNSDEVYVWESSAGGTFTITSAPESDMKLPARITLHLKEDQLEYLEARRLKELIKKHSEFIGYDIELMVEKTTEKEVTDEDEEEAKKADEDGEEPKVEEVTEGEEGKKKKTKKVKEVTKEYEVQNKHKPLWTRDPKDVTKEEYAAFYKAISNDWEDPPATKHFSVEGQLEFRAIMFVPKRAPFDMLEPNKKRNNIKLYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPLNISRENLQQNKILKVIRKNIVKKCLEMFEEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEVMTTLKDYVTRMKAEQNSIYYITGDSKKKLESSPFIEQAKRRGFEVLFMTEPYDEYVMQQVKDFEDKKFACLTKEGVHFEESEEEKRQREEEKATCEKLCKTMKEVLGDKVEKVTVSERLSTSPCILVTSEFGWSAHMEQMMRNQALRDSSMAQYMMSKKTMELNPKHPIIKELRRRVEADENDKAVKDLVFLLFDTSLLTSGFQLEDPTYAERINRMIKLGLSLDEEEEEEAVEAAVAETAPAEVTAGTSSMELVD

HSP83

Heat shock protein 83

452 amino acids

Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function (By similarity).

Belongs to the heat shock protein 90 family.

52.691 kDa

single

TKKVKEVTKEYEVQNKHKPLWTRDPKDVTKEEYAAFYKAISNDWEDPMATKHFSVEGQLEFRSIMFVPKRAPFDMFEPNKKRNNIKLYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPLNISRENLQQNKILKVIRKNIVKKCLEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANPKKLMEFLRFYSTESGLEMTTLKDYVTRMKEGQKSIYYITGDSKKKLESSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDFEDKKFACLTKEGVHFEESEEEKQQREEEKAACEKRCKTMKEVLGDKVEKVTVSDRLSTSPCILVTSEFGWSAHMEQIMRNQAVRDSSMSAYMMSKKTMELNPRHPIIKVLRRRVEADENDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAKRINRMIKLGLSLDEEEEAAEATVVETAPAEVTVGTSSMEQVD

Hsp83

Heat shock protein 83

375 amino acids

Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function. Required for piRNA biogenesis by facilitating loading of piRNAs into PIWI proteins (By similarity).

Belongs to the heat shock protein 90 family.

42.933 kDa

single

MPEEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVTSKNNDDEQYVWESSAGGSFTVRADNSEPLGRGTKIVLYIKEDQTDYLEESKIKEIVNKHSQFIGYPIKLLVEKEREKEVSDDEADDEKKEGDEKKEMETDEPKIEDVGEDEDADKKDKDAKKKKTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRTPFDLFENQKKRNNIKLYVRRVFIMDNCEDLIPEYLNFMKGVVD

Hsp83

Heat shock protein 83

374 amino acids

Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function. Required for piRNA biogenesis by facilitating loading of piRNAs into PIWI proteins (By similarity).

Belongs to the heat shock protein 90 family.

42.814 kDa

single

MPEEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVTSKNNDDEQYVWESSAGGSFTVRADNSEPLGRGTKIVLFIKEDQTDYLEESKIKEIVNKHSQFIGYPIKLLVEKEREKEVSDDEDDEKKEGDEKKEMDTDEPKIEDVGEDEDADKKDKDAKKKKTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRTPFDLFENQKKRNNIKLYVRRVFIMDNCEDLIPEYLNFIKGVVD

Hsp83

Heat shock protein 83

269 amino acids

Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function. Required for piRNA biogenesis by facilitating loading of piRNAs into PIWI proteins (By similarity).

Belongs to the heat shock protein 90 family.

30.103 kDa

single

MPEEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLIADRVTVTSKNNDDEQYVWESSAGGSFTVKADNSEPLGRGTKIXLYIKEDQTDYLEESKIKEIVNKHSQFIGYPIKLLVEKEREKEVSDDEADDEKKDDEAKKDMDTDEPKIEDVGEDEDADKKDKDGKKKKTIKEKY

Hsp83

Heat shock protein 83

269 amino acids

Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function. Required for piRNA biogenesis by facilitating loading of piRNAs into PIWI proteins (By similarity).

Belongs to the heat shock protein 90 family.

30.117 kDa

single

MPEEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYXSXTDPXKLXXXXXXXXXXIPNKTAGTLTIIDTGIXMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLIADRVTVTSKNNDDEQYVWESSAGGSFTVKADNSEPLGRGTKIXLYIKEDQTDYLEESKIKEIVNKHSQFIGYPXKXXXEKERXKEVSDDEADDEKKDDEAKKDMDTDEPKIEDVGEDEDADKKDKDGKKKKTIKEKY

Hsp83

Heat shock protein 83

269 amino acids

Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function. Required for piRNA biogenesis by facilitating loading of piRNAs into PIWI proteins (By similarity).

Belongs to the heat shock protein 90 family.

30.312 kDa

single

MPEEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLIADRVTVTSKNNDDEQYVWESXXXGSFTXKADNXEPLXRGTKIXLYIKEDQTDYLEESKIKEIVNKHSQFIGYPIKLLVEKEREKEVSDDEADDEKKDDEAKKDMDTDEPKIEDVGEDEDADKKDKDGKKKKTIKEKY