About Services Plasmids Contact

Hmuk_2215

Gene
Hmuk_2215
Protein
Putative lipoprotein Hmuk_2215
Organism
Halomicrobium mukohataei (strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541)
Length
201 amino acids
Mass
21.151 kDa
Sequence
MCPRPRRAVLLGLGVAMSAIAGCRETAPSTTQTSDGGPEPTGRSGDTQTDGGGETTRQATVAEGGESATRADETETSELDLREANVVDVTLQSAGGRAVEFSVTLYHDDDGEDGYADWWQVETLAGDRLGRRELLHAHSTAPFTRSETIEVPEGTTCVVVRGHDQTHGYGGQAMVVDTESGATRAVQQGPEPAEFDDGDCP