hspb11

Heat shock protein beta-11

205 amino acids

Belongs to the small heat shock protein (HSP20) family.

23.823 kDa

MLCPSTFQPHLSPFMDFHWPVRSLWPETRPLFFQFEQEMMRHMQEMRHNMEFMERLHQRIFDEIDHVSPMTTFKPISFQLGKEGSHYALTLDTQDFSPEELAVKQVGRKLRVSGKTEKKQDDGKGSYSYRCQEFRQEFDLPEDVNPESVSCSLNNGQLQIQAPREGNTVSNERVIPITYTPAVKNPALQNSEPENQAVEAEAAEN

HSPB11

Intraflagellar transport protein 25 homolog

144 amino acids

Component of the IFT complex B required for sonic hedgehog/SHH signaling. May mediate transport of SHH components: required for the export of SMO and PTCH1 receptors out of the cilium and the accumulation of GLI2 at the ciliary tip in response to activation of the SHH pathway, suggesting it is involved in the dynamic transport of SHH signaling molecules within the cilium. Not required for ciliary assembly. Its role in intraflagellar transport is mainly seen in tissues rich in ciliated cells such as kidney and testis. Essential for male fertility, spermiogenesis and sperm flagella formation. Plays a role in the early development of the kidney. May be involved in the regulation of ureteric bud initiation (By similarity).

Belongs to the IFT25 family.

16.297 kDa

MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS

HSPB11

Intraflagellar transport protein 25 homolog

144 amino acids

Component of the IFT complex B required for sonic hedgehog/SHH signaling. May mediate transport of SHH components: required for the export of SMO and PTCH1 receptors out of the cilium and the accumulation of GLI2 at the ciliary tip in response to activation of the SHH pathway, suggesting it is involved in the dynamic transport of SHH signaling molecules within the cilium. Not required for ciliary assembly. Its role in intraflagellar transport is mainly seen in tissues rich in ciliated cells such as kidney and testis. Essential for male fertility, spermiogenesis and sperm flagella formation. Plays a role in the early development of the kidney. May be involved in the regulation of ureteric bud initiation (By similarity).

Belongs to the IFT25 family.

16.297 kDa

MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS

Hspb11

Intraflagellar transport protein 25 homolog

143 amino acids

Component of the IFT complex B required for sonic hedgehog/SHH signaling. May mediate transport of SHH components: required for the export of SMO and PTCH1 receptors out of the cilium and the accumulation of GLI2 at the ciliary tip in response to activation of the SHH pathway, suggesting it is involved in the dynamic transport of SHH signaling molecules within the cilium. Not required for ciliary assembly (PubMed:22595669). Its role in intraflagellar transport is mainly seen in tissues rich in ciliated cells such as kidney and testis. Essential for male fertility, spermiogenesis and sperm flagella formation (PubMed:28430876). Plays a role in the early development of the kidney (PubMed:29626631). May be involved in the regulation of ureteric bud initiation (PubMed:29626631).

Belongs to the IFT25 family.

16.281 kDa

MRKVDLCSVTEGTEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVKIEKLVIQSYLVRTLRIEKTTSKEPLDFEQWVEKDLVHTEGQLQNEEIVARDGYATFLRFIIVSAFDHFASVHSISAEGLTVSSLP

Hspb11

Intraflagellar transport protein 25 homolog

143 amino acids

Component of the IFT complex B required for sonic hedgehog/SHH signaling. May mediate transport of SHH components: required for the export of SMO and PTCH1 receptors out of the cilium and the accumulation of GLI2 at the ciliary tip in response to activation of the SHH pathway, suggesting it is involved in the dynamic transport of SHH signaling molecules within the cilium. Not required for ciliary assembly (PubMed:22595669). Its role in intraflagellar transport is mainly seen in tissues rich in ciliated cells such as kidney and testis. Essential for male fertility, spermiogenesis and sperm flagella formation (PubMed:28430876). Plays a role in the early development of the kidney (PubMed:29626631). May be involved in the regulation of ureteric bud initiation (PubMed:29626631).

Belongs to the IFT25 family.

16.281 kDa

MRKVDLCSVTEGTEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVKIEKLVIQSYLVRTLRIEKTTSKEPLDFEQWVEKDLVHTEGQLQNEEIVARDGYATFLRFIIVSAFDHFASVHSISAEGLTVSSLP