HOXD4

Homeobox protein Hox-D4

255 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Belongs to the Antp homeobox family. Deformed subfamily.

27.885 kDa

MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPFGGSGPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARAYSQSDPKQPPSGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL

HOXD4

Homeobox protein Hox-D4

255 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Belongs to the Antp homeobox family. Deformed subfamily.

27.94 kDa

MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGTDYYGGGAQGADFQPPGLYPRPDFGEQPFGGGGPGTRSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARACSQSDPKQPPPGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSTAPSQHLQPMAKDHHTDLTTL

HOXD4

Homeobox protein Hox-D4

255 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Belongs to the Antp homeobox family. Deformed subfamily.

27.835 kDa

MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPFGGSGPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARACSQSDPKQPPPGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL

HOXD4

Homeobox protein Hox-D4

255 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Belongs to the Antp homeobox family. Deformed subfamily.

27.835 kDa

MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPFGGSGPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARACSQSDPKQPPPGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL

HOXD4

Homeobox protein Hox-D4

255 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Belongs to the Antp homeobox family. Deformed subfamily.

27.905 kDa

MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGAEYYGGGTQGADFQPPGLYPRPDFGEQPFGGGGPGTGSALPTRGHGQEPSGPGGHYAASGEPCPAPPAPPPAPLPGARACSQSDPKQPPPGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSTAPSQHLQPMAKDHHTDLTTL

HOXD4

Homeobox protein Hox-D4

255 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Belongs to the Antp homeobox family. Deformed subfamily.

27.94 kDa

MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGTDYYGGGAQGADFQPPGLYPRPDFGEQPFGGGGPGTRSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARACSQSDPKQPPPGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSTAPSQHLQPMAKDHHTDLTTL

HOXD4

Homeobox protein Hox-D4

255 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Belongs to the Antp homeobox family. Deformed subfamily.

27.776 kDa

MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPFGGSGPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGAPACSQSDPKQPPPGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL

Hoxd4

Homeobox protein Hox-D4

250 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Belongs to the Antp homeobox family. Deformed subfamily.

27.371 kDa

MAMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGSGAQGADFQPSGLYPRPDFGEQPFGGGGPGPGSALPARGHGQEPSGPGSHYGAPGERCPAPPPAPLPGARACSQPTGPKQPPPGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSCSSSAAPGQHLQPMAKDHHTDLTTL

HOXD4

Homeobox protein Hox-D4

235 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Binds to sites in the 5'-flanking sequence of its coding region with various affinities. The consensus sequences of the high and low affinity binding sites are 5'-TAATGA[CG]-3' and 5'-CTAATTTT-3'.

Belongs to the Antp homeobox family. Deformed subfamily.

26.662 kDa

MAMSSYMVNSYVDPKFPPCEEYLQSSYLGEQGAEYYGASQGSDFQHQGLYPRSNYSEQPFWLAGAQGSAVQPRGHGQEQSAPPSHFPGQAEHCPPPPCPIPSCGQQPALKAPHGSAVKQPAVVYPWMKKVHVNSVNPNYSGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSASNPHLQTVPKDHQTDLTTL

HOXD4

Homeobox protein Hox-D4

46 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Belongs to the Antp homeobox family. Deformed subfamily.

5.628 kDa

single

VNSNYTGGEPKRSRTAYTRQQVLELEKEFLFNRYLTRRRRIQHTLT