HOT13

Helper of Tim protein 13

116 amino acids

Required for the assembly or recycling of the small Tim proteins in the mitochondrial intermembrane, thereby participating in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Probably acts by facilitating the formation of disulfide bonds in small Tim proteins.

13.641 kDa

MIETAIYGKTVDDQSRCVHWHLPKDVIAIRFKCCDKYYACFECHQELSSHPLEKYDLLDDANKHLIICGVCRHEMTFAEYYDYNSNLICPNCRSPFNPGCKLHYHLYFQNPPPAMC

HOT13

Helper of Tim protein 13

114 amino acids

Required for the assembly or recycling of the small Tim proteins in the mitochondrial intermembrane, thereby participating in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane.

13.338 kDa

MEKAQIYGKLVDKESRCEHWHGPLDVIALRFKCCNGYYACYECHQELVPHVTERYNINDETVPLVICGVCKLEMSFAAYSDSLQCPNCRSQFNPGCKLHYDMYFMKDDEPENLR