About Services Plasmids Contact

HNE_3545

Gene
HNE_3545
Protein
UPF0434 protein HNE_3545
Organism
Hyphomonas neptunium (strain ATCC 15444)
Length
85 amino acids
Similarity
Belongs to the UPF0434 family.
Mass
9.276 kDa
Sequence
MSDLPDQTPKDDSVLFEANGVDPRLLEILICPATRQPLAYDRARHELVSKNARLAYPIRGGIPIMLEEEARDLDDTEGTAGGGEA