About Services Plasmids Contact

HNE_3437

Gene
HNE_3437
Protein
UPF0386 protein HNE_3437
Organism
Hyphomonas neptunium (strain ATCC 15444)
Length
85 amino acids
Similarity
Belongs to the UPF0386 family.
Mass
9.927 kDa
Sequence
MDISRAEQRILHLLAQGGRIDLVRDEAGKLTDAHCYSRDGWRYTGLDMALFRKLKRRRTIASERGQPYRITRRGLQLVRSQPDNC