About Services Plasmids Contact

HNE_2117

Gene
HNE_2117
Protein
PKHD-type hydroxylase HNE_2117
Organism
Hyphomonas neptunium (strain ATCC 15444)
Length
226 amino acids
Mass
24.66 kDa
Sequence
MLLHIPEVLNGQELATLRETLAGADWQDGAATAGAQAVRVKQNLQLPAGAPDARPMGELVKAALLRHPLFQSAALPHTVLTPRFNRYEGGGHYGNHVDSAIHADPFLGVSVRTDVSTTVFLNDPEDYDGGELIVEDTYGVHEVKLPAGDAILYPATSLHRVESVTRGTRLASFLWTQSRVRDDARRGMLFQLDMTILSLRGKLADAPEVVALTGHYHNLLRQWADA