About Services Plasmids Contact

HMT-1

Gene
HMT-1
Protein
Homocysteine S-methyltransferase 1
Organism
Arabidopsis thaliana
Length
326 amino acids
Function
Catalyzes methyl transfer from S-methylmethionine (SMM) to adenosyl-L-homocysteine (AdoMet). SMM degradation (by HMT-1, HMT-2 and HMT-3) and biosynthesis (by MMT1) constitute the SMM cycle in plants, which is probably required to achieve short term control of AdoMet level.
Mass
35.98 kDa
Sequence
MVLEKKSALLEDLIKKCGGCAVVDGGFATQLEIHGAAINDPLWSAVSLIKNPELIKRVHMEYLEAGADIVVTSSYQATIPGFLSRGLSIEESESLLQKSVELAVEARDRFWEKVSKVSGHSYNRALVAASIGSYGAYLADGSEYSGHYGENVSLDKLKDFHRRRLQVLVEAGPDLLAFETIPNKLEAQACVELLEEEKVQIPAWICFTSVDGEKAPSGESFEECLEPLNKSNNIYAVGINCAPPQFIENLIRKFAKLTKKAIVVYPNSGEVWDGKAKQWLPSQCFGDDEFEMFATKWRDLGAKLIGGCCRTTPSTINAISRDLKRR

Gene
HMT-1
Protein
Homocysteine S-methyltransferase 1
Organism
Zea mays
Length
323 amino acids
Function
Catalyzes methyl transfer from S-methylmethionine (SMM) to adenosyl-L-homocysteine (AdoMet). SMM degradation (by HMT-1, HMT-2, HMT-3 and HMT-4) and biosynthesis (by MMT1) constitute the SMM cycle in plants, which is probably required to achieve short term control of AdoMet level (By similarity).
Mass
34.927 kDa
Sequence
MGVLEDLVARAGGCAVIDGGFATQLEALGADINDPLWSAACLITRPHLVKEVHMQYLEAGADVIISSSYQATIPGFIARGMSVAEAEDLLRTSVKLANEARDEFWKSTLRKSKPIYNRALVAASIGSYGAYLADGSEYSGSYGADITAEKLKDFHRRRLQVLASAGPDLIAFEAIPNQMEAQALVELLEEEKVQIPSWICFSSVDGKNLCSGESFADCLKILNASEKVAVVGVNCTPPQFIEGIICEFRKQTKKAIAVYPNSGEVWDGRAKRWLPVECLGHKSFDALAKRWQEAGASLIGGCCRTTPSTIRAVSKILKGRTGH