About Services Plasmids Contact

HMLALPHA1

Gene
HMLALPHA1
Protein
Silenced mating-type protein ALPHA1
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Length
175 amino acids
Function
Mating type proteins are sequence specific DNA-binding proteins that act as master switches in yeast differentiation by controlling gene expression in a cell type-specific fashion. Silenced copy of ALPHA1 at HML.
Similarity
Belongs to the MATALPHA1 family.
Mass
20.413 kDa
Sequence
MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRFLNKIQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL

Gene
HMLALPHA1
Protein
Silenced mating-type protein ALPHA1
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Length
175 amino acids
Function
Mating type proteins are sequence specific DNA-binding proteins that act as master switches in yeast differentiation by controlling gene expression in a cell type-specific fashion. Silenced copy of ALPHA1 at HML.
Similarity
Belongs to the MATALPHA1 family.
Mass
20.413 kDa
Sequence
MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRFLNKIQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL