About Services Plasmids Contact

HMGXB4

Gene
HMGXB4
Protein
HMG domain-containing protein 4
Organism
Homo sapiens
Length
601 amino acids
Function
Negatively regulates Wnt/beta-catenin signaling during development.
Mass
65.712 kDa
Sequence
MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKRSYKDFLREEEEIAAQVRNSSKKKLKDSELYFLGTDTHKKKRKHSSDDYYYGDISSLESSQKKKKKSSPQSTDTAMDLLKAITSPLAAGSKPSKKTGEKSSGSSSHSESKKEHHRKKVSGSSGELPLEDGGSHKSKKMKPLYVNTETLTLREPDGLKMKLILSPKEKGSSSVDEESFQYPSQQATVKKSSKKSARDEQGALLLGHELQSFLKTARKKHKSSSDAHSSPGPEGCGSDASQFAESHSANLDLSGLEPILVESDSSSGGELEAGELVIDDSYREIKKKKKSKKSKKKKDKEKHKEKRHSKSKRSLGLSAVPVGEVTVTSGPPPSIPYAGAAAPPLPLPGLHTDGHSEKKKKKEEKDKERERGEKPKKKNMSAYQVFCKEYRVTIVADHPGIDFGELSKKLAEVWKQLPEKDKLIWKQKAQYLQHKQNKAEATTVKRKASSSEGSMKVKASSVGVLSPQKKSPPTTMLLPASPAKAPETEPIDVAAHLQLLGESLSLIGHRLQETEGMVAVSGSLSVLLDSIICALGPLACLTTQLPELNGCPKQVLSNTLDNIAYIMPGL

Gene
HMGXB4
Protein
HMG domain-containing protein 4
Organism
Homo sapiens
Length
601 amino acids
Function
Negatively regulates Wnt/beta-catenin signaling during development.
Mass
65.712 kDa
Sequence
MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKRSYKDFLREEEEIAAQVRNSSKKKLKDSELYFLGTDTHKKKRKHSSDDYYYGDISSLESSQKKKKKSSPQSTDTAMDLLKAITSPLAAGSKPSKKTGEKSSGSSSHSESKKEHHRKKVSGSSGELPLEDGGSHKSKKMKPLYVNTETLTLREPDGLKMKLILSPKEKGSSSVDEESFQYPSQQATVKKSSKKSARDEQGALLLGHELQSFLKTARKKHKSSSDAHSSPGPEGCGSDASQFAESHSANLDLSGLEPILVESDSSSGGELEAGELVIDDSYREIKKKKKSKKSKKKKDKEKHKEKRHSKSKRSLGLSAVPVGEVTVTSGPPPSIPYAGAAAPPLPLPGLHTDGHSEKKKKKEEKDKERERGEKPKKKNMSAYQVFCKEYRVTIVADHPGIDFGELSKKLAEVWKQLPEKDKLIWKQKAQYLQHKQNKAEATTVKRKASSSEGSMKVKASSVGVLSPQKKSPPTTMLLPASPAKAPETEPIDVAAHLQLLGESLSLIGHRLQETEGMVAVSGSLSVLLDSIICALGPLACLTTQLPELNGCPKQVLSNTLDNIAYIMPGL

Gene
hmgxb4
Protein
HMG box-containing protein 4
Organism
Xenopus laevis
Length
554 amino acids
Function
Negatively regulates Wnt/beta-catenin signaling during development.
Mass
60.91 kDa
Sequence
MSYRDLRECIDLERGTEDVGLAAGRSQREKKRSYKDLLREEEEIAEQVRKSSKKRSKELDLFSGNELHKKKKKHSSDDYHADHSTDSAKKKKKTSLPSPSSSDTAMDLLKAITSPQADTSTTHPSKKPEKILATPISFSSPSQPPHKDYHKKSGEVSGDDSSHRSKKSKPLTLREPDGLRMKLIMSPNEKSEEEAVSPQGGPGHSDSASSKKNSKKLGREEIESRSSHKKHKKQSYTPRSGGTPDSASSTGGELDAGELVIDDSLRDMKKKKKSKKSKKKKDKHKDEKHKKHSKSKREHEVEQSQTQIASPGLPSPPPPPATTPPTSPPSIPLQPQALVTHTEEQSDKKKKKEDPEKPKKKNMSAYQVFSKEYRVSIIAEHPGIDFGELSKKLAEVWKQLPEKDKLVWKQKAQYLQHKQNKAEATTVKRKSSSSESAPKSKGSSSGLVSPNKKSPTSSVASFSTSPAKVPDTEPIDVAAHLQLLGESLSLIGHRLQETEGMVAVSGSLSVLLDSILCALGPLVCLTSHVPQLNACPKQILSNTLDNIAYVMPGL

Gene
hmgxb4
Protein
HMG box-containing protein 4
Organism
Xenopus tropicalis
Length
554 amino acids
Function
Negatively regulates Wnt/beta-catenin signaling during development.
Mass
60.907 kDa
Sequence
MSFRDLRECIDSERGMEDVGLAAGRSQREKKRSYKDLLREEEEIAEQVRKSSKKRSRELDLFLASESHKKKKKHLTDDYHADTPSPDLAKKKKKALLPSPAPPSSSDTAMDLLKAITSPQVDTSTTHLPKKPEKILATPVNFSSPSQSSHKEHHKKIGEVSGDDSSHRSKKSKPLTLREPDGLRMKLILSPNEKSEEESASPQGGPGHSEGASSKKTSKKTGREETESRSSHKKHKKESHTPRSGGTPDSASSTGGELEAGELIIDDSFHEMKKKKKSKKSKKKKDKHKDEKHRKHSKSKREHEGEERPTQIASPVLPSPPPPTATTPTSPPSVPPQALITHAEEQLDKKKKKEDPEKPKKKNMSAYQVFSKEYRGSIIAEHPGIDFGELSKKLAEVWKQLPEKDKLAWKQKAQYLQHKQNKAEATTVKRKSSSSESAARSKGSSSGLPSPNKKSPTSVVSFSTSPAKVPDTEPIDVAAHLQLLGESLSLIGHRLQETEGMVAVSGSLSVLLDSILCALGPLVCLTSHVPQLNACPKQILSNTLDNIAYVMPGL

Gene
hmgxb4
Protein
HMG box-containing protein 4
Organism
Xenopus laevis
Length
554 amino acids
Function
Negatively regulates Wnt/beta-catenin signaling during development.
Mass
60.91 kDa
Sequence
MSYRDLRECIDLERGTEDVGLAAGRSQREKKRSYKDLLREEEEIAEQVRKSSKKRSKELDLFSGNELHKKKKKHSSDDYHADHSTDSAKKKKKTSLPSPSSSDTAMDLLKAITSPQADTSTTHPSKKPEKILATPISFSSPSQPPHKDYHKKSGEVSGDDSSHRSKKSKPLTLREPDGLRMKLIMSPNEKSEEEAVSPQGGPGHSDSASSKKNSKKLGREEIESRSSHKKHKKQSYTPRSGGTPDSASSTGGELDAGELVIDDSLRDMKKKKKSKKSKKKKDKHKDEKHKKHSKSKREHEVEQSQTQIASPGLPSPPPPPATTPPTSPPSIPLQPQALVTHTEEQSDKKKKKEDPEKPKKKNMSAYQVFSKEYRVSIIAEHPGIDFGELSKKLAEVWKQLPEKDKLVWKQKAQYLQHKQNKAEATTVKRKSSSSESAPKSKGSSSGLVSPNKKSPTSSVASFSTSPAKVPDTEPIDVAAHLQLLGESLSLIGHRLQETEGMVAVSGSLSVLLDSILCALGPLVCLTSHVPQLNACPKQILSNTLDNIAYVMPGL

Gene
hmgxb4
Protein
HMG box-containing protein 4
Organism
Xenopus tropicalis
Length
554 amino acids
Function
Negatively regulates Wnt/beta-catenin signaling during development.
Mass
60.907 kDa
Sequence
MSFRDLRECIDSERGMEDVGLAAGRSQREKKRSYKDLLREEEEIAEQVRKSSKKRSRELDLFLASESHKKKKKHLTDDYHADTPSPDLAKKKKKALLPSPAPPSSSDTAMDLLKAITSPQVDTSTTHLPKKPEKILATPVNFSSPSQSSHKEHHKKIGEVSGDDSSHRSKKSKPLTLREPDGLRMKLILSPNEKSEEESASPQGGPGHSEGASSKKTSKKTGREETESRSSHKKHKKESHTPRSGGTPDSASSTGGELEAGELIIDDSFHEMKKKKKSKKSKKKKDKHKDEKHRKHSKSKREHEGEERPTQIASPVLPSPPPPTATTPTSPPSVPPQALITHAEEQLDKKKKKEDPEKPKKKNMSAYQVFSKEYRGSIIAEHPGIDFGELSKKLAEVWKQLPEKDKLAWKQKAQYLQHKQNKAEATTVKRKSSSSESAARSKGSSSGLPSPNKKSPTSVVSFSTSPAKVPDTEPIDVAAHLQLLGESLSLIGHRLQETEGMVAVSGSLSVLLDSILCALGPLVCLTSHVPQLNACPKQILSNTLDNIAYVMPGL