About Services Plasmids Contact

HMGN5

Gene
Hmgn5
Protein
High mobility group nucleosome-binding domain-containing protein 5
Organism
Rattus norvegicus
Length
429 amino acids
Function
Preferentially binds to euchromatin and modulates cellular transcription by counteracting linker histone-mediated chromatin compaction.
Similarity
Belongs to the HMGN family.
Mass
48.605 kDa
Sequence
MPKRKAAGDASQEPKRRSARLSAMPVPFTPELKPKRASTSRKTKTTNVVEESKDAGATTIPETKPEVVKGECNMENAENGEAKIIEAPISKMETEEVKEQINEDTEGDGGEKKEAVVTKGKNDELEANIQDVEKDEDEKEHEDTGEEGEDGEREGGLKEKPDVAEIEDAKEAKDDEEKEDKEKEDDKGGDGKKEEEKDDEGEAETEEEVKEQQKEETEGDDGKCKVEENKEGRKESQHEEEGKEELHEEDGKEDLHEEDGKEDLHEEDGKEDLHEEEGKEDLHEEEGKEDLHEEEGKEDLHEEEGKEDLHEEEGKEDLHEEEGKEDLHEEEGKEDLHEEDGKEGQHEEEGKEDLHEEEGKEDLHEEDGKEGQHEEDGKKKADGNEDRKEEEEQEAATEGNDENKVEVEEEADNKDFKEDGEKGEPVSTV

Gene
Hmgn5
Protein
High mobility group nucleosome-binding domain-containing protein 5
Organism
Rattus norvegicus
Length
429 amino acids
Function
Preferentially binds to euchromatin and modulates cellular transcription by counteracting linker histone-mediated chromatin compaction.
Similarity
Belongs to the HMGN family.
Mass
48.605 kDa
Sequence
MPKRKAAGDASQEPKRRSARLSAMPVPFTPELKPKRASTSRKTKTTNVVEESKDAGATTIPETKPEVVKGECNMENAENGEAKIIEAPISKMETEEVKEQINEDTEGDGGEKKEAVVTKGKNDELEANIQDVEKDEDEKEHEDTGEEGEDGEREGGLKEKPDVAEIEDAKEAKDDEEKEDKEKEDDKGGDGKKEEEKDDEGEAETEEEVKEQQKEETEGDDGKCKVEENKEGRKESQHEEEGKEELHEEDGKEDLHEEDGKEDLHEEDGKEDLHEEEGKEDLHEEEGKEDLHEEEGKEDLHEEEGKEDLHEEEGKEDLHEEEGKEDLHEEEGKEDLHEEDGKEGQHEEEGKEDLHEEEGKEDLHEEDGKEGQHEEDGKKKADGNEDRKEEEEQEAATEGNDENKVEVEEEADNKDFKEDGEKGEPVSTV

Gene
Hmgn5
Protein
High mobility group nucleosome-binding domain-containing protein 5
Organism
Mus musculus
Length
406 amino acids
Function
Preferentially binds to euchromatin and modulates cellular transcription by counteracting linker histone-mediated chromatin compaction.
Similarity
Belongs to the HMGN family.
Mass
45.344 kDa
Sequence
MPKRKAAGDVSQEPKRRSARLSAMPVPFTPELKPKRASTSRKTKTTNVVEENKDASTIPIPETKPEDVKDECNMENAENGEAKIMEAPIPKMEAEEVKEQINEDTEEDGGEKKEAVAAEAKDDELKANIQDVEKDEDGKEHKDTGEEVEDGKIEEEGLNEKPGTAKSEDAEVSKDEEEKGDNEKGEDGKEEGDEKEEEKDDKEGDTGTEKEVKEQNKEAEEDDGKCKEEENKEVGKEGQPEEDGKEDLHEEVGKEDLHEEDGKEGQPEEDGKEIHHEEDGKEGQPEEDGKEYLHEEDGEEGQPKEDQKEGQPEEDGKEDQPEEDGKEGQCKEDGKEGHHEEGGKEDLHEEDGKEKDGGKEDRKEEGEQEVAVDEGSDENKVEAEEEGAENKDFKQDGEKEEPLSIV

Gene
Hmgn5
Protein
High mobility group nucleosome-binding domain-containing protein 5
Organism
Mus musculus
Length
406 amino acids
Function
Preferentially binds to euchromatin and modulates cellular transcription by counteracting linker histone-mediated chromatin compaction.
Similarity
Belongs to the HMGN family.
Mass
45.344 kDa
Sequence
MPKRKAAGDVSQEPKRRSARLSAMPVPFTPELKPKRASTSRKTKTTNVVEENKDASTIPIPETKPEDVKDECNMENAENGEAKIMEAPIPKMEAEEVKEQINEDTEEDGGEKKEAVAAEAKDDELKANIQDVEKDEDGKEHKDTGEEVEDGKIEEEGLNEKPGTAKSEDAEVSKDEEEKGDNEKGEDGKEEGDEKEEEKDDKEGDTGTEKEVKEQNKEAEEDDGKCKEEENKEVGKEGQPEEDGKEDLHEEVGKEDLHEEDGKEGQPEEDGKEIHHEEDGKEGQPEEDGKEYLHEEDGEEGQPKEDQKEGQPEEDGKEDQPEEDGKEGQCKEDGKEGHHEEGGKEDLHEEDGKEKDGGKEDRKEEGEQEVAVDEGSDENKVEAEEEGAENKDFKQDGEKEEPLSIV

Gene
HMGN5
Protein
High mobility group nucleosome-binding domain-containing protein 5
Organism
Homo sapiens
Length
282 amino acids
Function
Preferentially binds to euchromatin and modulates cellular transcription by counteracting linker histone-mediated chromatin compaction.
Similarity
Belongs to the HMGN family.
Mass
31.525 kDa
Sequence
MPKRKAAGQGDMRQEPKRRSARLSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSAQAVAETKQEAVVEEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVAAEVKNEEEDQKEDEEDQNEEKGEAGKEDKDEKGEEDGKEDKNGNEKGEDAKEKEDGKKGEDGKGNGEDGKEKGEDEKEEEDRKETGDGKENEDGKEKGDKKEGKDVKVKEDEKEREDGKEDEGGNEEEAGKEKEDLKEEEEGKEEDEIKEDDGKKEEPQSIV

Gene
HMGN5
Protein
High mobility group nucleosome-binding domain-containing protein 5
Organism
Homo sapiens
Length
282 amino acids
Function
Preferentially binds to euchromatin and modulates cellular transcription by counteracting linker histone-mediated chromatin compaction.
Similarity
Belongs to the HMGN family.
Mass
31.525 kDa
Sequence
MPKRKAAGQGDMRQEPKRRSARLSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSAQAVAETKQEAVVEEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVAAEVKNEEEDQKEDEEDQNEEKGEAGKEDKDEKGEEDGKEDKNGNEKGEDAKEKEDGKKGEDGKGNGEDGKEKGEDEKEEEDRKETGDGKENEDGKEKGDKKEGKDVKVKEDEKEREDGKEDEGGNEEEAGKEKEDLKEEEEGKEEDEIKEDDGKKEEPQSIV