About Services Plasmids Contact

HMGN1

Gene
HMGN1
Protein
Non-histone chromosomal protein HMG-14
Organism
Bos taurus
Length
101 amino acids
Function
Binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. May be involved in the process which maintains transcribable genes in a unique chromatin conformation. Inhibits the phosphorylation of nucleosomal histones H3 and H2A by RPS6KA5/MSK1 and RPS6KA3/RSK2 (By similarity).
Similarity
Belongs to the HMGN family.
Mass
10.831 kDa
Sequence
MPKRKVSSAEGAAKEEPKRRSARLSAKPAPAKVETKPKKAAGKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKNEESPASDEAEEKEAKSD

Gene
HMGN1
Protein
Non-histone chromosomal protein HMG-14
Organism
Homo sapiens
Length
100 amino acids
Function
Binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. May be involved in the process which maintains transcribable genes in a unique chromatin conformation. Inhibits the phosphorylation of nucleosomal histones H3 and H2A by RPS6KA5/MSK1 and RPS6KA3/RSK2 (By similarity).
Similarity
Belongs to the HMGN family.
Mass
10.659 kDa
Sequence
MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD

Gene
Hmgn1
Protein
Non-histone chromosomal protein HMG-14
Organism
Mus musculus
Length
96 amino acids
Function
Binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. May be involved in the process which maintains transcribable genes in a unique chromatin conformation. Inhibits the phosphorylation of nucleosomal histones H3 and H2A by RPS6KA5/MSK1 and RPS6KA3/RSK2.
Similarity
Belongs to the HMGN family.
Mass
10.152 kDa
Sequence
MPKRKVSADGAAKAEPKRRSARLSAKPAPAKVDAKPKKAAGKDKASDKKVQIKGKRGAKGKQADVADQQTTELPAENGETENQSPASEEEKEAKSD