About Services Plasmids Contact

HMGA1

Gene
HMGA1
Protein
High mobility group protein HMG-I/HMG-Y
Organism
Canis lupus familiaris
Length
107 amino acids
Function
HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double-stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the transcription regulation of genes containing, or in close proximity to A+T-rich regions (By similarity).
Similarity
Belongs to the HMGA family.
Mass
11.676 kDa
Sequence
MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ

Gene
HMGA1
Protein
High mobility group protein HMG-I/HMG-Y
Organism
Cricetulus griseus
Length
107 amino acids
Function
HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double-stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the transcription regulation of genes containing, or in close proximity to A+T-rich regions (By similarity).
Similarity
Belongs to the HMGA family.
Mass
11.616 kDa
Sequence
MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKATTAPGRKPRGRPKKLEKEEEEGISQESSEEEQ

Gene
HMGA1
Protein
High mobility group protein HMG-I/HMG-Y
Organism
Homo sapiens
Length
107 amino acids
Function
HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double-stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the transcription regulation of genes containing, or in close proximity to A+T-rich regions.
Similarity
Belongs to the HMGA family.
Mass
11.676 kDa
Sequence
MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ

Gene
Hmga1
Protein
High mobility group protein HMG-I/HMG-Y
Organism
Mus musculus
Length
107 amino acids
Function
HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double-stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the transcription regulation of genes containing, or in close proximity to A+T-rich regions.
Similarity
Belongs to the HMGA family.
Mass
11.614 kDa
Sequence
MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKVTTAPGRKPRGRPKKLEKEEEEGISQESSEEEQ

Gene
Hmga1
Protein
High mobility group protein HMG-I/HMG-Y
Organism
Rattus norvegicus
Length
107 amino acids
Function
HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double-stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the transcription regulation of genes containing, or in close proximity to A+T-rich regions (By similarity).
Similarity
Belongs to the HMGA family.
Mass
11.706 kDa
Sequence
MSESVSKSSQPLASKQEKDGTEKRGRGRPRKQPSVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGTAKTRKVTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ