About Services Proteins Contact

HI_1250

Gene
HI_1250
Protein
Uncharacterized protein HI_1250
Organism
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Length
101 amino acids
Mass
12.249 kDa
Sequence
MFNLKREHFRDDYLYRFYQYGDTHSKIPSNLYKVLARKLDMISASENINDLRSPPANHLELLEPKENKIYSIRVNKQYCLIFKYENNEVNNLYLDPHSYNL