About Services Proteins Contact

HI_1099

Gene
HI_1099
Protein
Uncharacterized protein HI_1099
Organism
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Length
102 amino acids
Mass
11.601 kDa
Sequence
MYLMRKIVFVSCVILGLAACSSQPEQIGGGVYDMKTVQEYNARVISGNTVTQTQKDKITQQIDTSLKLNQSDNKVKTRTRRVLPVLPVTPSVGYHYNYHYFR