About Services Proteins Contact

HI_0488

Gene
HI_0488
Protein
Uncharacterized protein HI_0488
Organism
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Length
200 amino acids
Similarity
Belongs to the HAD-like hydrolase superfamily. CbbY/CbbZ/Gph/YieH family.
Mass
22.522 kDa
Sequence
MLDYEIFNPYEGLIFDMDGTLIDTMPVHAQAWTMVGKKFGYEFDFQIMYNFGGATVRTIAGEMMKAANMPLDRIEDVLAAKRELSYQLIPTQSKLLPTFEIVKSFHQKKPIALGSGSHRKIIDMLMDKLAIAPYFNAIVSADDVKEHKPHPETFLRCAELIQANPSRCIVFEDADLGVQAGLSAGMDVFDVRTREIISPR