About Services Proteins Contact

HI_0453

Gene
HI_0453
Protein
Uncharacterized protein HI_0453
Organism
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Length
174 amino acids
Mass
20.416 kDa
Sequence
MRKFFKYFLFIVVFLFHGFMFSVVNYVFPHYDVTRVTGVEVKRVDKDGPITKSNPADGPTRDVYYINTQNDDGKIMVYRNEDTRWGFPFYFKFGSANLQAEAQALGNDNKLVQIKYYGWRITMVDEYRNATSIKEITADDTPSNPIVSWILYVFLLATLFLSIQFIRGWFDSDK