About Services Plasmids Contact

HIST1H2BC

Gene
HIST1H2BC
Protein
Histone H2B type 1-C/E/F/G/I
Organism
Homo sapiens
Length
126 amino acids
Function
Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid.
Similarity
Belongs to the histone H2B family.
Mass
13.906 kDa
Sequence
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Gene
Hist1h2bc
Protein
Histone H2B type 1-C/E/G
Organism
Mus musculus
Length
126 amino acids
Function
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Similarity
Belongs to the histone H2B family.
Mass
13.906 kDa
Sequence
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK