HIGD2A

HIG1 domain family member 2A, mitochondrial

106 amino acids

Proposed subunit of cytochrome c oxidase (COX, complex IV), which is the terminal component of the mitochondrial respiratory chain that catalyzes the reduction of oxygen to water. May be involved in cytochrome c oxidase activity. May play a role in the assembly of respiratory supercomplexes.

11.529 kDa

MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRGNSQRSQLMMRTRIAAQGFTVAAILLGLAVTAMKSRP

Higd2a

HIG1 domain family member 2A

106 amino acids

Proposed subunit of cytochrome c oxidase (COX, complex IV), which is the terminal component of the mitochondrial respiratory chain that catalyzes the reduction of oxygen to water. May be involved in cytochrome c oxidase activity. May play a role in the assembly of respiratory supercomplexes (By similarity).

11.368 kDa

MAAPGPVSPEAPFDPSKPPVIEGFSPTVYSNPEGFKEKFIRKTRENPMVPIGCLGTAAALTYGLYCFHRGQSHRSQLMMRTRIAAQGFTVVAILLGLAASAMKSQA