HERV-K104

Endogenous retrovirus group K member 104 Pro protein

156 amino acids

Retroviral proteases have roles in the processing of the primary translation products and the maturation of the viral particle. Endogenous Pro proteins may have kept, lost or modified their original function during evolution (By similarity).

Belongs to the peptidase A2 family. HERV class-II K(HML-2) subfamily.

17.121 kDa

WASQVSENRPVCKAIIQGKQFEGLVDTEADVSIIALNQWPKNWPKQKAVTGLVGIGTASEVYQSTEILHCLGPDNQESTVQPMITSIPLNLWGQDLLQQWGAEITMPAPLYSPTSQKIMTKMGYIPGKGLGKNEDGIKVPVEAKINQKREGIGYPF

HERV-K104

Endogenous retrovirus group K member 104 Rec protein

105 amino acids

Retroviral replication requires the nuclear export and translation of unspliced, singly-spliced and multiply-spliced derivatives of the initial genomic transcript. Rec interacts with a highly structured RNA element (RcRE) present in the viral 3'LTR and recruits the cellular nuclear export machinery. This permits export to the cytoplasm of unspliced genomic or incompletely spliced subgenomic viral transcripts (By similarity).

11.735 kDa

MNPSEMQRKAPPRRRRHCNRAPLTHKMNKMVTSEEEMKLPSTKKAEPLTWAQLKKLTQLATKCLENTKVTQTPESMLLAALMIVSMVSAGVTNSSKETATIENGP