HACD4

Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4

232 amino acids

Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.

Belongs to the very long-chain fatty acids dehydratase HACD family.

27.52 kDa

MGPLALPAWLQPRYRKNAYLFIYYLIQFCGHSWIFTNMTVRFFSFGKDSMVDTFYAIGLVMRLCQSVSLLELLHIYVGIESNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVFWNLLDMVRYTYSMLSVIGISYAVLTWLSQTLWMPIYPLCVLAEAFAIYQSLPYFESFGTYSTKLPFDLSIYFPYVLKIYLMMLFIGMYFTYSHLYSERRDILGIFPIKKKKM

Hacd4

Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4

232 amino acids

Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.

Belongs to the very long-chain fatty acids dehydratase HACD family.

27.235 kDa

MGPSVLPAWLQPRYRKNVYLFIYYLIQFCGHSWILANMTVRFFSFGKDSMADTFYAIGLVMRVCQSISLLELLHIYIGIESNQLFPRFLQLTERVIILFGVITSQEEVQEKCVVCVLFILWNLLDMVRYTYSMLSVIGTSYAALTWLSQTLWMPIYPLCVLAEAFTIYQSLPYFESFGTNSTVLPFDLSTCFPYVLKLYLMMLFIGMYFTYSHLYTERKDFLRVFSVKQKNV

HACD4

Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4

232 amino acids

Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.

Belongs to the very long-chain fatty acids dehydratase HACD family.

27.52 kDa

MGPLALPAWLQPRYRKNAYLFIYYLIQFCGHSWIFTNMTVRFFSFGKDSMVDTFYAIGLVMRLCQSVSLLELLHIYVGIESNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVFWNLLDMVRYTYSMLSVIGISYAVLTWLSQTLWMPIYPLCVLAEAFAIYQSLPYFESFGTYSTKLPFDLSIYFPYVLKIYLMMLFIGMYFTYSHLYSERRDILGIFPIKKKKM

Hacd4

Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4

232 amino acids

Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.

Belongs to the very long-chain fatty acids dehydratase HACD family.

27.235 kDa

MGPSVLPAWLQPRYRKNVYLFIYYLIQFCGHSWILANMTVRFFSFGKDSMADTFYAIGLVMRVCQSISLLELLHIYIGIESNQLFPRFLQLTERVIILFGVITSQEEVQEKCVVCVLFILWNLLDMVRYTYSMLSVIGTSYAALTWLSQTLWMPIYPLCVLAEAFTIYQSLPYFESFGTNSTVLPFDLSTCFPYVLKLYLMMLFIGMYFTYSHLYTERKDFLRVFSVKQKNV

HACD4

Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4

231 amino acids

Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.

Belongs to the very long-chain fatty acids dehydratase HACD family.

27.559 kDa

MGPVALPTWLQPRYRKNAYLFIYYLIQFCGHSWIFTNMTVRFFSFGKDSMVDTFYAIGLVMQLCQSISLLELLHIYVGIESNHLLPRILQLTERIIVLFMVITSQEEVQEKYVVCVLFIFRNLLDMVRYTYSMLSVIGISYAVLTWFSQTLWMPIYPLCVLAEAFTIYQSLPYFESFGTYSTKLPFDLSFYFPYVLKIYLMMLFVGMYFTYNHLYSERRDILRVFPNKKKM

HACD4

Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4

231 amino acids

Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.

Belongs to the very long-chain fatty acids dehydratase HACD family.

27.559 kDa

MGPVALPTWLQPRYRKNAYLFIYYLIQFCGHSWIFTNMTVRFFSFGKDSMVDTFYAIGLVMQLCQSISLLELLHIYVGIESNHLLPRILQLTERIIVLFMVITSQEEVQEKYVVCVLFIFRNLLDMVRYTYSMLSVIGISYAVLTWFSQTLWMPIYPLCVLAEAFTIYQSLPYFESFGTYSTKLPFDLSFYFPYVLKIYLMMLFVGMYFTYNHLYSERRDILRVFPNKKKM

hacd4

Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase

218 amino acids

Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.

Belongs to the very long-chain fatty acids dehydratase HACD family.

25.736 kDa

MKTYLSIYYLIQFCGHSWIFTNMTTRFLFFGQDAFADTFYSIGLVMQGCQLLSILELAHILLGVEQNGFLPMFLQVAERFIILFVVITSQEEVQSKYIVCALFFIWNLWDVIRYPYDMLAAVDTDYSALTWLRHTWWIVAYPLSVLAEAYTIYESLPYFESLGTYSFKMALPVSLSFHFPYILTLYLVLQPVGMLYICSCLWSERKQYFQRKLKLKKN

hacd4

Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase

218 amino acids

Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.

Belongs to the very long-chain fatty acids dehydratase HACD family.

25.736 kDa

MKTYLSIYYLIQFCGHSWIFTNMTTRFLFFGQDAFADTFYSIGLVMQGCQLLSILELAHILLGVEQNGFLPMFLQVAERFIILFVVITSQEEVQSKYIVCALFFIWNLWDVIRYPYDMLAAVDTDYSALTWLRHTWWIVAYPLSVLAEAYTIYESLPYFESLGTYSFKMALPVSLSFHFPYILTLYLVLQPVGMLYICSCLWSERKQYFQRKLKLKKN