HACD3

Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3

364 amino acids

Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. Involved in Rac1-signaling pathways leading to the modulation of gene expression.

Belongs to the very long-chain fatty acids dehydratase HACD family.

43.337 kDa

MAMENQVLTPHVYWAQRHRELYLRVELSDVQNPAISTTENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKESFYDTFHTVADMMYFCQMLAVVETINAAIGVTTSPVLPSLIQLLGRNFILFIIFGTMEEMQNKAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWEVLTWLRYTLWIPLYPLGCLAEAVSVVQSIPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQRRRRYGQKKKKIH

HACD3

Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3

364 amino acids

Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. Involved in Rac1-signaling pathways leading to the modulation of gene expression.

Belongs to the very long-chain fatty acids dehydratase HACD family.

43.337 kDa

MAMENQVLTPHVYWAQRHRELYLRVELSDVQNPAISTTENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKESFYDTFHTVADMMYFCQMLAVVETINAAIGVTTSPVLPSLIQLLGRNFILFIIFGTMEEMQNKAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWEVLTWLRYTLWIPLYPLGCLAEAVSVVQSIPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQRRRRYGQKKKKIH

HACD3

Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3

362 amino acids

Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. Involved in Rac1-signaling pathways leading to the modulation of gene expression. Promotes insulin receptor/INSR autophosphorylation and is involved in INSR internalization (By similarity).

Belongs to the very long-chain fatty acids dehydratase HACD family.

43.133 kDa

MENQVLTPHVYWAQRHHELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKESQWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEEQLNKLRLESQGSPETLTSLKKGYLFMYNLVQFLGFSWIFVNMTVRFFILGKESFYDTFHTVADMMYFCQMLAAVESINAAIGVTKSPVVPSLFQLLGRNFILFIIFGTMEEMQNKAVVFFVFYIWSTVEIFRYPFYMLSCIDMDWKVLTWLRYTVWIPLYPMGCLAEAVSVIQSIPVFNETGRFSFTLPYPVKIKVRFSFFLQIYLILLFLGLYVNFRYLYKQRRRRFGQKKKKIH

HACD3

Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase

362 amino acids

Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. Involved in Rac1-signaling pathways leading to the modulation of gene expression.

Belongs to the very long-chain fatty acids dehydratase HACD family.

42.835 kDa

MADCSLRPHVHWAQRHRELYLRVELSDVKNPDVSIADNVLRFRAQGHGAKGDNIYEFQIEFLEPVEPKPVCRVTQRQLNITVQKKESSWWERLTKQEKRPLFLAPDFDRWLDESDAEMELKEKEEEKINKMKIESRVPKDPFKHLKKGYLIMYNLVQFLGFSWIFVNMTVRLFILGKDSFYDTFHTIADMMYFCQTLALMEILNSLIGLVRSPLIPAVIQVFGRNFILFVVLGSLEEMQSKAVVFFLFYFWSIIELFRYPYYMLSCMGIEWKPLTWLRYTSWIPLYPLGGLAEAVCLIQSIPIFSETGKFSLGLPNPLNVTIQFSFLLQMYLIALFLGLFVNFRYLYKQRKQHLGPKKRKMK

HACD3

Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3

362 amino acids

Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. May be involved in Rac1-signaling pathways leading to the modulation of gene expression. Promotes insulin receptor/INSR autophosphorylation and is involved in INSR internalization (PubMed:25687571).

Belongs to the very long-chain fatty acids dehydratase HACD family.

43.16 kDa

MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKESFYDTFHTVADMMYFCQMLAVVETINAAIGVTTSPVLPSLIQLLGRNFILFIIFGTMEEMQNKAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWKVLTWLRYTLWIPLYPLGCLAEAVSVIQSIPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQRRRRYGQKKKKIH

Hacd3

Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3

362 amino acids

Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. Involved in Rac1-signaling pathways leading to the modulation of gene expression. Promotes insulin receptor/INSR autophosphorylation and is involved in INSR internalization (By similarity).

Belongs to the very long-chain fatty acids dehydratase HACD family.

43.131 kDa

METQVLTPHVYWAQRHRELYLRVELSDVQNPAISITDNVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPAYRLTQRQVNITVQKKGSHWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEERLNKLRLEREGSPETLTNLKKGYLFMYNLVQLLGFSWIFVNLTVRFFILGKESFYDTFHNVADMMYFCQMLALVETLNAAIGVTSTPVLPALIQFLGRNFILFLVFGTMEEMQNKAVVFFVFYSWSAIEIFRYPFYMLSCIDMDWKVLTWLRYTMWIPLYPLGCLSEAVAVIQSIPVFNESGRFSFTLPYPVKMKVRFSFFLQVYLVMLFLGLYINFRHLYKQRRRRYGQKKKKLH

HACD3

Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3

362 amino acids

Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. Involved in Rac1-signaling pathways leading to the modulation of gene expression. Promotes insulin receptor/INSR autophosphorylation and is involved in INSR internalization (By similarity).

Belongs to the very long-chain fatty acids dehydratase HACD family.

43.133 kDa

MENQVLTPHVYWAQRHHELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKESQWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEEQLNKLRLESQGSPETLTSLKKGYLFMYNLVQFLGFSWIFVNMTVRFFILGKESFYDTFHTVADMMYFCQMLAAVESINAAIGVTKSPVVPSLFQLLGRNFILFIIFGTMEEMQNKAVVFFVFYIWSTVEIFRYPFYMLSCIDMDWKVLTWLRYTVWIPLYPMGCLAEAVSVIQSIPVFNETGRFSFTLPYPVKIKVRFSFFLQIYLILLFLGLYVNFRYLYKQRRRRFGQKKKKIH

HACD3

Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase

362 amino acids

Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. Involved in Rac1-signaling pathways leading to the modulation of gene expression.

Belongs to the very long-chain fatty acids dehydratase HACD family.

42.835 kDa

MADCSLRPHVHWAQRHRELYLRVELSDVKNPDVSIADNVLRFRAQGHGAKGDNIYEFQIEFLEPVEPKPVCRVTQRQLNITVQKKESSWWERLTKQEKRPLFLAPDFDRWLDESDAEMELKEKEEEKINKMKIESRVPKDPFKHLKKGYLIMYNLVQFLGFSWIFVNMTVRLFILGKDSFYDTFHTIADMMYFCQTLALMEILNSLIGLVRSPLIPAVIQVFGRNFILFVVLGSLEEMQSKAVVFFLFYFWSIIELFRYPYYMLSCMGIEWKPLTWLRYTSWIPLYPLGGLAEAVCLIQSIPIFSETGKFSLGLPNPLNVTIQFSFLLQMYLIALFLGLFVNFRYLYKQRKQHLGPKKRKMK

HACD3

Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3

362 amino acids

Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. May be involved in Rac1-signaling pathways leading to the modulation of gene expression. Promotes insulin receptor/INSR autophosphorylation and is involved in INSR internalization (PubMed:25687571).

Belongs to the very long-chain fatty acids dehydratase HACD family.

43.16 kDa

MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKESFYDTFHTVADMMYFCQMLAVVETINAAIGVTTSPVLPSLIQLLGRNFILFIIFGTMEEMQNKAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWKVLTWLRYTLWIPLYPLGCLAEAVSVIQSIPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQRRRRYGQKKKKIH

Hacd3

Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3

362 amino acids

Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. Involved in Rac1-signaling pathways leading to the modulation of gene expression. Promotes insulin receptor/INSR autophosphorylation and is involved in INSR internalization (By similarity).

Belongs to the very long-chain fatty acids dehydratase HACD family.

43.131 kDa

METQVLTPHVYWAQRHRELYLRVELSDVQNPAISITDNVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPAYRLTQRQVNITVQKKGSHWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEERLNKLRLEREGSPETLTNLKKGYLFMYNLVQLLGFSWIFVNLTVRFFILGKESFYDTFHNVADMMYFCQMLALVETLNAAIGVTSTPVLPALIQFLGRNFILFLVFGTMEEMQNKAVVFFVFYSWSAIEIFRYPFYMLSCIDMDWKVLTWLRYTMWIPLYPLGCLSEAVAVIQSIPVFNESGRFSFTLPYPVKMKVRFSFFLQVYLVMLFLGLYINFRHLYKQRRRRYGQKKKKLH

hacd3

Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase

359 amino acids

Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. Involved in Rac1-signaling pathways leading to the modulation of gene expression.

Belongs to the very long-chain fatty acids dehydratase HACD family.

42.412 kDa

MSALTPHVYWAQRHGEIYLRVEISDAQDLSIGVEENILQFRGQGHGAKGENEYEFSLEFLKPVKPEVKHKSTQRQVNITVRKQEEVWWNRLTKQEKKPLFLAPDFDRWLDESDAEMELREKEEKINKVSFESRVRKDPFLGLKKGFLFMYNLVQFLGYSWIFVNMTVRLFILGQDSFYDTFHTIADVMYFCQMLAIMEVINPAVGLVKTGVMPAFIQVMGRNFILFVIFGSLEDMQNKPVVFFVFYLWSTIEIFRYPFYMLACIDTEWKLLTWLRYTIWMPLYPLGVLAEAVAVIQSIPIFDETKLLSIPLPKATGLSLSFSYILQLYLVVMFLGLFINFRHLFKQRTRRFRTKKRKAN

hacd3

Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase

359 amino acids

Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. Involved in Rac1-signaling pathways leading to the modulation of gene expression.

Belongs to the very long-chain fatty acids dehydratase HACD family.

42.412 kDa

MSALTPHVYWAQRHGEIYLRVEISDAQDLSIGVEENILQFRGQGHGAKGENEYEFSLEFLKPVKPEVKHKSTQRQVNITVRKQEEVWWNRLTKQEKKPLFLAPDFDRWLDESDAEMELREKEEKINKVSFESRVRKDPFLGLKKGFLFMYNLVQFLGYSWIFVNMTVRLFILGQDSFYDTFHTIADVMYFCQMLAIMEVINPAVGLVKTGVMPAFIQVMGRNFILFVIFGSLEDMQNKPVVFFVFYLWSTIEIFRYPFYMLACIDTEWKLLTWLRYTIWMPLYPLGVLAEAVAVIQSIPIFDETKLLSIPLPKATGLSLSFSYILQLYLVVMFLGLFINFRHLFKQRTRRFRTKKRKAN