About Services Proteins Contact

GstD2

Gene
GstD2
Protein
Glutathione S-transferase D2
Organism
Drosophila melanogaster
Length
215 amino acids
Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles (PubMed:22082028). May be involved in detoxification (PubMed:22082028).
Similarity
Belongs to the GST superfamily. Delta family.
Mass
24.535 kDa
Sequence
MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDLKRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVSRWYDNAKKVTPGWDENWEGLMAMKALFDARKLAAK

Gene
GstD2
Protein
Glutathione S-transferase 2
Organism
Anopheles gambiae
Length
209 amino acids
Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Similarity
Belongs to the GST superfamily. Theta family.
Mass
23.543 kDa
Sequence
MLDFYYLPGSAPCRAVQMVAEAVHVKLNLKYLDLMAGAHRSPQFTKLNPQRTIPTLVDGSLILSESRAALIYLCDQYGDEDNDWYPRDTIQRAIVNQRLFFDACVLYPRFADFYHPQVFGNAAPDGRKRLAFEKAVELLNIFLSEHEFVAGSKMTIADISLFATLATACTLGFILRPYVHVDRWYVTMVASCPGAQANVSGAKEFLTYK